BLASTX nr result
ID: Phellodendron21_contig00030267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030267 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_001109547.1 hypothetical protein Poptr_cp068 [Populus trichoc... 58 2e-09 KQJ96841.1 hypothetical protein BRADI_3g27343, partial [Brachypo... 52 6e-07 KQJ95761.1 hypothetical protein BRADI_3g18879, partial [Brachypo... 52 6e-07 >YP_001109547.1 hypothetical protein Poptr_cp068 [Populus trichocarpa] YP_001109572.1 hypothetical protein Poptr_cp095 [Populus trichocarpa] ABO36751.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] ABO36776.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 61 Score = 57.8 bits (138), Expect = 2e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 LNYPEDALYIFYQKDGQSNLFLDSIEAQRGE 95 LNYPEDAL I YQK+GQSNLFLDSIEA+RGE Sbjct: 31 LNYPEDALSILYQKNGQSNLFLDSIEAKRGE 61 >KQJ96841.1 hypothetical protein BRADI_3g27343, partial [Brachypodium distachyon] KQK18208.1 hypothetical protein BRADI_1g05797, partial [Brachypodium distachyon] Length = 98 Score = 52.4 bits (124), Expect = 6e-07 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = -1 Query: 205 ILC*HMDPYVVTFHLGLGIGVIGPAFYISLVICLGPYSPLWASIESRNRFDCPS 44 ILC H +PYV+TF+LGLGIGV PAF IS++ G + L+ + +R CP+ Sbjct: 9 ILCLHRNPYVLTFYLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLCPT 62 >KQJ95761.1 hypothetical protein BRADI_3g18879, partial [Brachypodium distachyon] Length = 98 Score = 52.4 bits (124), Expect = 6e-07 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = -1 Query: 205 ILC*HMDPYVVTFHLGLGIGVIGPAFYISLVICLGPYSPLWASIESRNRFDCPS 44 ILC H +PYV+TF+LGLGIGV PAF IS++ G + L+ + +R CP+ Sbjct: 9 ILCLHRNPYVLTFYLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLCPT 62