BLASTX nr result
ID: Phellodendron21_contig00030266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00030266 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007278599.1 dockerin type 1 [Colletotrichum gloeosporioides N... 67 9e-11 CCF32022.1 hypothetical protein CH063_04482 [Colletotrichum higg... 64 3e-10 KZL87569.1 dockerin type 1 [Colletotrichum incanum] OHW95252.1 h... 66 3e-10 KZL77341.1 dockerin type 1 [Colletotrichum tofieldiae] 65 6e-10 XP_018160139.1 Dockerin type 1 [Colletotrichum higginsianum IMI ... 64 1e-09 XP_003043218.1 hypothetical protein NECHADRAFT_51482 [Nectria ha... 64 2e-09 CRK20053.1 hypothetical protein BN1708_003312, partial [Verticil... 62 5e-09 XP_009649003.1 hypothetical protein VDAG_04261 [Verticillium dah... 62 5e-09 KKY37887.1 putative dockerin type 1 [Diaporthe ampelina] 60 5e-08 CRK41019.1 hypothetical protein BN1708_008420 [Verticillium long... 59 1e-07 CRK37239.1 hypothetical protein BN1723_004292, partial [Verticil... 59 1e-07 KDN64513.1 hypothetical protein CSUB01_00470 [Colletotrichum sub... 59 1e-07 XP_001907613.1 hypothetical protein [Podospora anserina S mat+] ... 58 2e-07 XP_008098342.1 hypothetical protein GLRG_09466 [Colletotrichum g... 58 2e-07 XP_003043208.1 hypothetical protein NECHADRAFT_51559 [Nectria ha... 57 3e-07 XP_018037789.1 hypothetical protein CC84DRAFT_1143950 [Paraphaeo... 57 3e-07 OLN94131.1 hypothetical protein CCHL11_07163 [Colletotrichum chl... 57 5e-07 OHX00719.1 hypothetical protein CSPAE12_00559 [Colletotrichum in... 56 7e-07 KZL74390.1 dockerin type 1 [Colletotrichum incanum] 56 7e-07 CEL07568.1 hypothetical protein ASPCAL10725 [Aspergillus calidou... 56 7e-07 >XP_007278599.1 dockerin type 1 [Colletotrichum gloeosporioides Nara gc5] ELA32327.1 dockerin type 1 [Colletotrichum gloeosporioides Nara gc5] Length = 436 Score = 67.4 bits (163), Expect = 9e-11 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 G GS+ V SGEEASLVVANTPA L L+DPF L S +N G YSF LSGAT Sbjct: 386 GQGSVSVASGEEASLVVANTPANLVLYDPFALTSEVNTGVDYSFTLSGAT 435 >CCF32022.1 hypothetical protein CH063_04482 [Colletotrichum higginsianum] Length = 181 Score = 63.9 bits (154), Expect = 3e-10 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 G+GS+ V EEASLVVANTPA L LFDPF L + +N G YSF LSGAT Sbjct: 131 GAGSVSVAGDEEASLVVANTPANLVLFDPFALSAEVNTGVDYSFTLSGAT 180 >KZL87569.1 dockerin type 1 [Colletotrichum incanum] OHW95252.1 hypothetical protein CSPAE12_06199 [Colletotrichum incanum] Length = 454 Score = 65.9 bits (159), Expect = 3e-10 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 G+GS+ V GEEASLVV NTPA L LFDPF L + +N G YSF LSGAT Sbjct: 404 GAGSVSVSGGEEASLVVVNTPANLVLFDPFALSAEVNTGVDYSFTLSGAT 453 >KZL77341.1 dockerin type 1 [Colletotrichum tofieldiae] Length = 454 Score = 65.1 bits (157), Expect = 6e-10 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 G+G++ V GEEASLVVANTPA L LFDPF L + +N G YSF LSGAT Sbjct: 404 GAGTVSVAGGEEASLVVANTPANLVLFDPFALSAEVNTGIDYSFTLSGAT 453 >XP_018160139.1 Dockerin type 1 [Colletotrichum higginsianum IMI 349063] OBR11622.1 Dockerin type 1 [Colletotrichum higginsianum IMI 349063] Length = 454 Score = 63.9 bits (154), Expect = 1e-09 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 G+GS+ V EEASLVVANTPA L LFDPF L + +N G YSF LSGAT Sbjct: 404 GAGSVSVAGDEEASLVVANTPANLVLFDPFALSAEVNTGVDYSFTLSGAT 453 >XP_003043218.1 hypothetical protein NECHADRAFT_51482 [Nectria haematococca mpVI 77-13-4] EEU37505.1 hypothetical protein NECHADRAFT_51482 [Nectria haematococca mpVI 77-13-4] Length = 400 Score = 63.5 bits (153), Expect = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTPALALFDPFLLDSNMNAGAQYSFELSGATV 154 +GS ++ V SGEE SLVVANTP+L LFDPF L + G YSF L+GATV Sbjct: 349 DGSATVTVASGEEVSLVVANTPSLILFDPFNLSAEAKKGLDYSFTLTGATV 399 >CRK20053.1 hypothetical protein BN1708_003312, partial [Verticillium longisporum] CRK22348.1 hypothetical protein BN1723_012671, partial [Verticillium longisporum] Length = 430 Score = 62.4 bits (150), Expect = 5e-09 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTP-ALALFDPFLLDSNMNAGAQYSFELSGAT 151 +G+GS+ V++GEE SLV+ANTP AL LFDPF L S ++ G YSF ++GAT Sbjct: 379 DGAGSVAVEAGEEVSLVIANTPEALVLFDPFNLSSEVSQGLSYSFTVTGAT 429 >XP_009649003.1 hypothetical protein VDAG_04261 [Verticillium dahliae VdLs.17] EGY22823.1 hypothetical protein VDAG_04261 [Verticillium dahliae VdLs.17] Length = 430 Score = 62.4 bits (150), Expect = 5e-09 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTP-ALALFDPFLLDSNMNAGAQYSFELSGAT 151 +G+GS+ V++GEE SLV+ANTP AL LFDPF L S ++ G YSF ++GAT Sbjct: 379 DGAGSVAVEAGEEVSLVIANTPEALVLFDPFNLSSEVSQGLSYSFTVTGAT 429 >KKY37887.1 putative dockerin type 1 [Diaporthe ampelina] Length = 439 Score = 59.7 bits (143), Expect = 5e-08 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPALALFDPFLLDSNMNAGAQYSFELSGAT 151 GS S V S EEAS+VVANTPAL +DPF + S++NAG Y+ L+GAT Sbjct: 390 GSASASVTSSEEASVVVANTPALIQYDPFSIGSDVNAGLDYTLTLTGAT 438 >CRK41019.1 hypothetical protein BN1708_008420 [Verticillium longisporum] Length = 408 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTP-ALALFDPFLLDSNMNAGAQYSFELSGA 148 +G+GS+ V +GEE SLVVANTP L LFDPF L S ++ G YSF ++GA Sbjct: 357 DGAGSVAVKAGEEVSLVVANTPEVLVLFDPFKLSSEVSQGLSYSFTVTGA 406 >CRK37239.1 hypothetical protein BN1723_004292, partial [Verticillium longisporum] Length = 430 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTP-ALALFDPFLLDSNMNAGAQYSFELSGA 148 +G+GS+ V +GEE SLVVANTP L LFDPF L S ++ G YSF ++GA Sbjct: 379 DGAGSVAVKAGEEVSLVVANTPEVLVLFDPFKLSSEVSQGLSYSFTVTGA 428 >KDN64513.1 hypothetical protein CSUB01_00470 [Colletotrichum sublineola] Length = 433 Score = 58.5 bits (140), Expect = 1e-07 Identities = 33/53 (62%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTP-ALALFDPF-LLDSNMNAGAQYSFELSGATV 154 +G+GS +V SGEEASLV+ANTP L L+D F L DS N G YSF L+GATV Sbjct: 380 DGAGSAEVASGEEASLVIANTPKTLILYDGFQLADSEANKGLNYSFTLTGATV 432 >XP_001907613.1 hypothetical protein [Podospora anserina S mat+] CAP68285.1 unnamed protein product [Podospora anserina S mat+] CDP31757.1 Putative protein of unknown function [Podospora anserina S mat+] Length = 433 Score = 58.2 bits (139), Expect = 2e-07 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 8 SGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGATV 154 SG++ V +GEEA LVV NTPA L LFDPF L + N G Y+ ++SGATV Sbjct: 384 SGNVSVGNGEEAMLVVVNTPANLVLFDPFKLTAETNTGVDYTVQISGATV 433 >XP_008098342.1 hypothetical protein GLRG_09466 [Colletotrichum graminicola M1.001] EFQ34322.1 hypothetical protein GLRG_09466 [Colletotrichum graminicola M1.001] Length = 433 Score = 57.8 bits (138), Expect = 2e-07 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTP-ALALFDPF-LLDSNMNAGAQYSFELSGATV 154 G+GS +V SGEEASLV+ANTP L L+D F L DS N G YSF L+GATV Sbjct: 381 GAGSAEVASGEEASLVIANTPKTLILYDGFQLADSEANKGLDYSFTLTGATV 432 >XP_003043208.1 hypothetical protein NECHADRAFT_51559 [Nectria haematococca mpVI 77-13-4] EEU37495.1 hypothetical protein NECHADRAFT_51559, partial [Nectria haematococca mpVI 77-13-4] Length = 398 Score = 57.4 bits (137), Expect = 3e-07 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPA-LALFDPFLLDSNMNAGAQYSFELSGAT 151 GSGSI+V GEE SLVVANTPA L+D F L S++ G YSF LSGAT Sbjct: 348 GSGSIEVSDGEEISLVVANTPADPILYDGFKLTSDVQKGLDYSFTLSGAT 397 >XP_018037789.1 hypothetical protein CC84DRAFT_1143950 [Paraphaeosphaeria sporulosa] OAG07424.1 hypothetical protein CC84DRAFT_1143950 [Paraphaeosphaeria sporulosa] Length = 461 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTPALALFDPFLLDSNMNAGAQYSFELSGATV 154 G+ S+ + SGEE +LVVANTP L L+DPF + + +N G +S +++GATV Sbjct: 412 GNASVTLASGEEITLVVANTPTLVLYDPFSIPAELNKGLTFSVQITGATV 461 >OLN94131.1 hypothetical protein CCHL11_07163 [Colletotrichum chlorophyti] Length = 433 Score = 56.6 bits (135), Expect = 5e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTP-ALALFDPF-LLDSNMNAGAQYSFELSGATV 154 G+GS + SGEE SLVVANTP AL L+D F L DS N G YSF LSGA+V Sbjct: 381 GAGSATIASGEEVSLVVANTPKALILYDGFKLADSEANKGLDYSFTLSGASV 432 >OHX00719.1 hypothetical protein CSPAE12_00559 [Colletotrichum incanum] Length = 434 Score = 56.2 bits (134), Expect = 7e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTP-ALALFDPF-LLDSNMNAGAQYSFELSGATV 154 G+GS +V SGEEASLVVANTP L L+D F L S N G YSF L+GATV Sbjct: 382 GAGSAEVTSGEEASLVVANTPKTLILYDGFELASSEANKGLDYSFTLTGATV 433 >KZL74390.1 dockerin type 1 [Colletotrichum incanum] Length = 434 Score = 56.2 bits (134), Expect = 7e-07 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = +2 Query: 5 GSGSIKVDSGEEASLVVANTP-ALALFDPF-LLDSNMNAGAQYSFELSGATV 154 G+GS +V SGEEASLVVANTP L L+D F L S N G YSF L+GATV Sbjct: 382 GAGSAEVTSGEEASLVVANTPKTLILYDGFELASSEANKGLDYSFTLTGATV 433 >CEL07568.1 hypothetical protein ASPCAL10725 [Aspergillus calidoustus] Length = 435 Score = 56.2 bits (134), Expect = 7e-07 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 2 EGSGSIKVDSGEEASLVVANTPALAL-FDPFLLDSNMNAGAQYSFELSGA 148 +GSGS+ +D G+EASLVVANTP+ + +DPF L + + AG YS +++GA Sbjct: 384 DGSGSVTMDDGDEASLVVANTPSTVIQYDPFSLTAEVQAGLNYSVQVTGA 433