BLASTX nr result
ID: Phellodendron21_contig00029756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029756 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416299.1 hypothetical protein MELLADRAFT_73180 [Melampsora... 53 4e-06 >XP_007416299.1 hypothetical protein MELLADRAFT_73180 [Melampsora larici-populina 98AG31] EGG00453.1 hypothetical protein MELLADRAFT_73180 [Melampsora larici-populina 98AG31] Length = 103 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = -2 Query: 209 WAMRLPNRLRKGLFNIQHRPEACLKKILKVDLPRSLHLSPLKV 81 WA RLP RLR+GL N+QHRP+ACL I+ LP S L L + Sbjct: 39 WAHRLPKRLRQGLRNLQHRPDACLNVIMNASLPPSRALGQLPI 81