BLASTX nr result
ID: Phellodendron21_contig00029713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029713 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIY70158.1 hypothetical protein CYLTODRAFT_488311 [Cylindrobasid... 54 4e-06 XP_019015074.1 heparinase II/III family protein [Kwoniella pini ... 54 5e-06 >KIY70158.1 hypothetical protein CYLTODRAFT_488311 [Cylindrobasidium torrendii FP15055 ss-10] Length = 778 Score = 54.3 bits (129), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 106 TVSVLFTPQWGNGFKAVSGTSSVALASWSLTSHS 5 T+ VLFTPQWG+GFKAV+ SSVAL SWSLTSH+ Sbjct: 746 TIEVLFTPQWGSGFKAVT-PSSVALDSWSLTSHN 778 >XP_019015074.1 heparinase II/III family protein [Kwoniella pini CBS 10737] OCF53855.1 heparinase II/III family protein [Kwoniella pini CBS 10737] Length = 786 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 112 SQTVSVLFTPQWGNGFKAVSGTSSVALASWSLTSHS 5 S ++ VLFTPQWGNGF AV ++VAL SWSLTSH+ Sbjct: 751 SFSLQVLFTPQWGNGFTAVDAPANVALDSWSLTSHN 786