BLASTX nr result
ID: Phellodendron21_contig00029692
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029692 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444222.1 hypothetical protein CICLE_v10022826mg [Citrus cl... 60 2e-09 KDO57159.1 hypothetical protein CISIN_1g039987mg [Citrus sinensis] 59 2e-09 XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus cl... 62 2e-09 XP_006436998.1 hypothetical protein CICLE_v10033342mg [Citrus cl... 58 9e-09 KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] 54 1e-07 XP_006446802.1 hypothetical protein CICLE_v10018103mg, partial [... 52 3e-06 >XP_006444222.1 hypothetical protein CICLE_v10022826mg [Citrus clementina] ESR57462.1 hypothetical protein CICLE_v10022826mg [Citrus clementina] Length = 132 Score = 60.1 bits (144), Expect = 2e-09 Identities = 33/91 (36%), Positives = 55/91 (60%), Gaps = 4/91 (4%) Frame = -1 Query: 263 MSSNTSANSREM*----CQYGFQQLKISGSDKNPNRKYWKCENCKVFDWVDVNEIVDTNV 96 MSS+TS E+ C + L+ S + +NPNR++WKC+ C F+W D + + N Sbjct: 1 MSSSTSEIQTEVKACDKCCNNNKVLRTSRTKENPNRRFWKCKGCGAFEWDDDWKSSECND 60 Query: 95 YQWIEDRKINELKNNILLDEVGQLGITLQLM 3 ++ +EDR IN+ K ++LL EV +LG ++ + Sbjct: 61 FRGMEDRIINKNKIDMLLAEVRKLGHQIECL 91 >KDO57159.1 hypothetical protein CISIN_1g039987mg [Citrus sinensis] Length = 105 Score = 59.3 bits (142), Expect = 2e-09 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 4/85 (4%) Frame = -1 Query: 263 MSSNTSANSREM*-CQYGFQQLKI---SGSDKNPNRKYWKCENCKVFDWVDVNEIVDTNV 96 MS +TS N ++ C+ F K+ S + +NPNRK+WKC+ C F W D + + N Sbjct: 1 MSFSTSDNRTQLKACEKCFNSSKVLRTSHTRENPNRKFWKCKGCGAFKWDDDRKSSECND 60 Query: 95 YQWIEDRKINELKNNILLDEVGQLG 21 ++ + DR ++E K +ILL EV +LG Sbjct: 61 FRGMVDRNMSENKIDILLGEVCKLG 85 >XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] ESR55842.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] Length = 266 Score = 62.0 bits (149), Expect = 2e-09 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 4/94 (4%) Frame = -1 Query: 272 VIEMSSNTSANSREM*----CQYGFQQLKISGSDKNPNRKYWKCENCKVFDWVDVNEIVD 105 +I S+TS N ++ C + L+IS + +NPN K+WKC+ C F+W D + + Sbjct: 128 IIMSCSSTSENRTQVKACEKCSNSNKVLRISRTRENPNCKFWKCKGCGAFEWDDNWKSSE 187 Query: 104 TNVYQWIEDRKINELKNNILLDEVGQLGITLQLM 3 N + +EDR +NE K +ILL EV LG ++ + Sbjct: 188 CNDFGGMEDRSMNENKIDILLGEVRSLGHQMECL 221 >XP_006436998.1 hypothetical protein CICLE_v10033342mg [Citrus clementina] XP_006438989.1 hypothetical protein CICLE_v10033562mg [Citrus clementina] XP_006439138.1 hypothetical protein CICLE_v10033800mg [Citrus clementina] XP_006440522.1 hypothetical protein CICLE_v10022823mg [Citrus clementina] ESR50238.1 hypothetical protein CICLE_v10033342mg [Citrus clementina] ESR52229.1 hypothetical protein CICLE_v10033562mg [Citrus clementina] ESR52378.1 hypothetical protein CICLE_v10033800mg [Citrus clementina] ESR53762.1 hypothetical protein CICLE_v10022823mg [Citrus clementina] Length = 132 Score = 58.2 bits (139), Expect = 9e-09 Identities = 26/61 (42%), Positives = 42/61 (68%) Frame = -1 Query: 203 LKISGSDKNPNRKYWKCENCKVFDWVDVNEIVDTNVYQWIEDRKINELKNNILLDEVGQL 24 L+ S + +NPNR++WKC+ C F+W D + + N ++ +EDR IN+ K ++LL EV +L Sbjct: 25 LRTSRTKENPNRRFWKCKGCGAFEWDDDWKSSECNDFRGMEDRIINQNKIDMLLAEVRKL 84 Query: 23 G 21 G Sbjct: 85 G 85 >KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] Length = 99 Score = 54.3 bits (129), Expect = 1e-07 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = -1 Query: 260 SSNTSANSREM*CQYGFQ-QLKISGSDKNPNRKYWKCENCKVFDWVDVNEIVDTNVYQWI 84 S+N S NS ++ + G Q +L S + KNPNRK+WKC CK F QW Sbjct: 4 STNESRNSLQVCNECGGQIELFTSHTTKNPNRKFWKCRVCKNF--------------QWA 49 Query: 83 EDRKINELKNNILLDEVGQLGITLQ 9 EDRK + K ++L++EV +L + ++ Sbjct: 50 EDRKFSNEKIDLLVEEVRKLTLEIE 74 >XP_006446802.1 hypothetical protein CICLE_v10018103mg, partial [Citrus clementina] ESR60042.1 hypothetical protein CICLE_v10018103mg, partial [Citrus clementina] Length = 144 Score = 52.0 bits (123), Expect = 3e-06 Identities = 20/48 (41%), Positives = 33/48 (68%) Frame = -1 Query: 203 LKISGSDKNPNRKYWKCENCKVFDWVDVNEIVDTNVYQWIEDRKINEL 60 L+ S + +NPNRK+WKC+ C+ F+W D + + V + +EDR I+E+ Sbjct: 90 LRTSRTRENPNRKFWKCKGCRAFEWDDDRKNSEYTVCRGVEDRNISEI 137