BLASTX nr result
ID: Phellodendron21_contig00029691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029691 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57159.1 hypothetical protein CISIN_1g039987mg [Citrus sinensis] 63 8e-11 XP_006436998.1 hypothetical protein CICLE_v10033342mg [Citrus cl... 58 9e-09 XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus cl... 60 1e-08 XP_006444222.1 hypothetical protein CICLE_v10022826mg [Citrus cl... 58 1e-08 XP_006446802.1 hypothetical protein CICLE_v10018103mg, partial [... 55 2e-07 KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] 53 6e-07 >KDO57159.1 hypothetical protein CISIN_1g039987mg [Citrus sinensis] Length = 105 Score = 62.8 bits (151), Expect = 8e-11 Identities = 34/84 (40%), Positives = 52/84 (61%), Gaps = 4/84 (4%) Frame = -1 Query: 263 MSFNTSANSREM*-CQYGFQQLKI---SGSNKNPNRKYWKCENCKAFDWADVNEIVDTNV 96 MSF+TS N ++ C+ F K+ S + +NPNRK+WKC+ C AF W D + + N Sbjct: 1 MSFSTSDNRTQLKACEKCFNSSKVLRTSHTRENPNRKFWKCKGCGAFKWDDDRKSSECND 60 Query: 95 YQWIEDRRINELKNNILLDEVGQL 24 ++ + DR ++E K +ILL EV +L Sbjct: 61 FRGMVDRNMSENKIDILLGEVCKL 84 >XP_006436998.1 hypothetical protein CICLE_v10033342mg [Citrus clementina] XP_006438989.1 hypothetical protein CICLE_v10033562mg [Citrus clementina] XP_006439138.1 hypothetical protein CICLE_v10033800mg [Citrus clementina] XP_006440522.1 hypothetical protein CICLE_v10022823mg [Citrus clementina] ESR50238.1 hypothetical protein CICLE_v10033342mg [Citrus clementina] ESR52229.1 hypothetical protein CICLE_v10033562mg [Citrus clementina] ESR52378.1 hypothetical protein CICLE_v10033800mg [Citrus clementina] ESR53762.1 hypothetical protein CICLE_v10022823mg [Citrus clementina] Length = 132 Score = 58.2 bits (139), Expect = 9e-09 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = -1 Query: 203 LKISGSNKNPNRKYWKCENCKAFDWADVNEIVDTNVYQWIEDRRINELKNNILLDEVGQL 24 L+ S + +NPNR++WKC+ C AF+W D + + N ++ +EDR IN+ K ++LL EV +L Sbjct: 25 LRTSRTKENPNRRFWKCKGCGAFEWDDDWKSSECNDFRGMEDRIINQNKIDMLLAEVRKL 84 >XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] ESR55842.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] Length = 266 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -1 Query: 224 CQYGFQQLKISGSNKNPNRKYWKCENCKAFDWADVNEIVDTNVYQWIEDRRINELKNNIL 45 C + L+IS + +NPN K+WKC+ C AF+W D + + N + +EDR +NE K +IL Sbjct: 148 CSNSNKVLRISRTRENPNCKFWKCKGCGAFEWDDNWKSSECNDFGGMEDRSMNENKIDIL 207 Query: 44 LDEVGQL 24 L EV L Sbjct: 208 LGEVRSL 214 >XP_006444222.1 hypothetical protein CICLE_v10022826mg [Citrus clementina] ESR57462.1 hypothetical protein CICLE_v10022826mg [Citrus clementina] Length = 132 Score = 57.8 bits (138), Expect = 1e-08 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = -1 Query: 203 LKISGSNKNPNRKYWKCENCKAFDWADVNEIVDTNVYQWIEDRRINELKNNILLDEVGQL 24 L+ S + +NPNR++WKC+ C AF+W D + + N ++ +EDR IN+ K ++LL EV +L Sbjct: 25 LRTSRTKENPNRRFWKCKGCGAFEWDDDWKSSECNDFRGMEDRIINKNKIDMLLAEVRKL 84 >XP_006446802.1 hypothetical protein CICLE_v10018103mg, partial [Citrus clementina] ESR60042.1 hypothetical protein CICLE_v10018103mg, partial [Citrus clementina] Length = 144 Score = 54.7 bits (130), Expect = 2e-07 Identities = 21/48 (43%), Positives = 34/48 (70%) Frame = -1 Query: 203 LKISGSNKNPNRKYWKCENCKAFDWADVNEIVDTNVYQWIEDRRINEL 60 L+ S + +NPNRK+WKC+ C+AF+W D + + V + +EDR I+E+ Sbjct: 90 LRTSRTRENPNRKFWKCKGCRAFEWDDDRKNSEYTVCRGVEDRNISEI 137 >KDO67836.1 hypothetical protein CISIN_1g041503mg [Citrus sinensis] Length = 99 Score = 52.8 bits (125), Expect = 6e-07 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%) Frame = -1 Query: 260 SFNTSANSREM*CQYGFQ-QLKISGSNKNPNRKYWKCENCKAFDWADVNEIVDTNVYQWI 84 S N S NS ++ + G Q +L S + KNPNRK+WKC CK F QW Sbjct: 4 STNESRNSLQVCNECGGQIELFTSHTTKNPNRKFWKCRVCKNF--------------QWA 49 Query: 83 EDRRINELKNNILLDEVGQLWITLQ 9 EDR+ + K ++L++EV +L + ++ Sbjct: 50 EDRKFSNEKIDLLVEEVRKLTLEIE 74