BLASTX nr result
ID: Phellodendron21_contig00029684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029684 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006486789.1 PREDICTED: protein trichome birefringence-like 12... 74 1e-12 XP_006422665.1 hypothetical protein CICLE_v10028582mg [Citrus cl... 74 1e-12 OMO92116.1 PC-Esterase [Corchorus olitorius] 67 1e-11 GAV65103.1 PC-Esterase domain-containing protein/PMR5N domain-co... 71 2e-11 XP_010092545.1 hypothetical protein L484_010434 [Morus notabilis... 70 3e-11 XP_018859862.1 PREDICTED: protein trichome birefringence-like 12... 69 8e-11 XP_007041482.2 PREDICTED: protein trichome birefringence-like 12... 69 9e-11 EOX97313.1 Gb:AAD15463.1 isoform 1 [Theobroma cacao] 69 9e-11 EEF44070.1 conserved hypothetical protein [Ricinus communis] 69 1e-10 XP_017224009.1 PREDICTED: protein trichome birefringence-like 12... 69 1e-10 XP_015574188.1 PREDICTED: protein trichome birefringence-like 12... 69 1e-10 KMT00956.1 hypothetical protein BVRB_9g222210 [Beta vulgaris sub... 68 2e-10 XP_010691475.1 PREDICTED: protein trichome birefringence-like 12... 68 3e-10 XP_017618528.1 PREDICTED: protein trichome birefringence-like 12... 68 3e-10 XP_016711701.1 PREDICTED: protein trichome birefringence-like 12... 68 3e-10 XP_012467743.1 PREDICTED: protein trichome birefringence-like 12... 68 3e-10 XP_015956161.1 PREDICTED: protein trichome birefringence-like 12... 67 4e-10 XP_015892474.1 PREDICTED: protein trichome birefringence-like 12... 67 5e-10 XP_016184602.1 PREDICTED: protein trichome birefringence-like 12... 67 6e-10 OAY39405.1 hypothetical protein MANES_10G092300 [Manihot esculenta] 66 6e-10 >XP_006486789.1 PREDICTED: protein trichome birefringence-like 12 isoform X1 [Citrus sinensis] Length = 401 Score = 74.3 bits (181), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDILSELIRN FET Sbjct: 369 WGQDCMHWCLPGVPDTWVDILSELIRNSFET 399 >XP_006422665.1 hypothetical protein CICLE_v10028582mg [Citrus clementina] ESR35905.1 hypothetical protein CICLE_v10028582mg [Citrus clementina] Length = 401 Score = 74.3 bits (181), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDILSELIRN FET Sbjct: 369 WGQDCMHWCLPGVPDTWVDILSELIRNSFET 399 >OMO92116.1 PC-Esterase [Corchorus olitorius] Length = 99 Score = 67.0 bits (162), Expect = 1e-11 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDC+HWCLPGVPDTWVDIL +LI NR ET Sbjct: 68 WGQDCLHWCLPGVPDTWVDILVQLIYNRLET 98 >GAV65103.1 PC-Esterase domain-containing protein/PMR5N domain-containing protein [Cephalotus follicularis] Length = 399 Score = 71.2 bits (173), Expect = 2e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDIL+ELIR+R ET Sbjct: 368 WGQDCMHWCLPGVPDTWVDILAELIRHRLET 398 >XP_010092545.1 hypothetical protein L484_010434 [Morus notabilis] EXB51454.1 hypothetical protein L484_010434 [Morus notabilis] Length = 410 Score = 70.5 bits (171), Expect = 3e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDC+HWCLPGVPDTWVDILSELIR FET Sbjct: 380 WGQDCLHWCLPGVPDTWVDILSELIRTGFET 410 >XP_018859862.1 PREDICTED: protein trichome birefringence-like 12 isoform X2 [Juglans regia] Length = 394 Score = 69.3 bits (168), Expect = 8e-11 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVD+LSELIR ET Sbjct: 363 WGQDCMHWCLPGVPDTWVDVLSELIRGSLET 393 >XP_007041482.2 PREDICTED: protein trichome birefringence-like 12 [Theobroma cacao] Length = 403 Score = 69.3 bits (168), Expect = 9e-11 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDIL++LI N FET Sbjct: 372 WGQDCMHWCLPGVPDTWVDILAQLILNSFET 402 >EOX97313.1 Gb:AAD15463.1 isoform 1 [Theobroma cacao] Length = 403 Score = 69.3 bits (168), Expect = 9e-11 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDIL++LI N FET Sbjct: 372 WGQDCMHWCLPGVPDTWVDILAQLILNSFET 402 >EEF44070.1 conserved hypothetical protein [Ricinus communis] Length = 375 Score = 68.9 bits (167), Expect = 1e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDILSELIR ET Sbjct: 344 WGQDCMHWCLPGVPDTWVDILSELIRTSTET 374 >XP_017224009.1 PREDICTED: protein trichome birefringence-like 12 [Daucus carota subsp. sativus] KZM81670.1 hypothetical protein DCAR_029283 [Daucus carota subsp. sativus] Length = 402 Score = 68.9 bits (167), Expect = 1e-10 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDILS+LIR+ ET Sbjct: 371 WGQDCMHWCLPGVPDTWVDILSQLIRDSLET 401 >XP_015574188.1 PREDICTED: protein trichome birefringence-like 12 [Ricinus communis] Length = 405 Score = 68.9 bits (167), Expect = 1e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDILSELIR ET Sbjct: 374 WGQDCMHWCLPGVPDTWVDILSELIRTSTET 404 >KMT00956.1 hypothetical protein BVRB_9g222210 [Beta vulgaris subsp. vulgaris] Length = 310 Score = 67.8 bits (164), Expect = 2e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRF 417 WGQDCMHWCLPGVPDTWVDILSELIR F Sbjct: 280 WGQDCMHWCLPGVPDTWVDILSELIRYNF 308 >XP_010691475.1 PREDICTED: protein trichome birefringence-like 12 [Beta vulgaris subsp. vulgaris] Length = 402 Score = 67.8 bits (164), Expect = 3e-10 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRF 417 WGQDCMHWCLPGVPDTWVDILSELIR F Sbjct: 372 WGQDCMHWCLPGVPDTWVDILSELIRYNF 400 >XP_017618528.1 PREDICTED: protein trichome birefringence-like 12 [Gossypium arboreum] Length = 404 Score = 67.8 bits (164), Expect = 3e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPG+PDTWVDIL +LI N FET Sbjct: 373 WGQDCMHWCLPGLPDTWVDILVQLIHNSFET 403 >XP_016711701.1 PREDICTED: protein trichome birefringence-like 12 [Gossypium hirsutum] Length = 404 Score = 67.8 bits (164), Expect = 3e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPG+PDTWVDIL +LI N FET Sbjct: 373 WGQDCMHWCLPGLPDTWVDILVQLIHNSFET 403 >XP_012467743.1 PREDICTED: protein trichome birefringence-like 12 [Gossypium raimondii] XP_016708271.1 PREDICTED: protein trichome birefringence-like 12 [Gossypium hirsutum] KJB16053.1 hypothetical protein B456_002G211100 [Gossypium raimondii] KJB16054.1 hypothetical protein B456_002G211100 [Gossypium raimondii] Length = 404 Score = 67.8 bits (164), Expect = 3e-10 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPG+PDTWVDIL +LI N FET Sbjct: 373 WGQDCMHWCLPGLPDTWVDILVQLIHNSFET 403 >XP_015956161.1 PREDICTED: protein trichome birefringence-like 12 [Arachis duranensis] Length = 399 Score = 67.4 bits (163), Expect = 4e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFE 414 WGQDCMHWCLPGVPDTWVDILS+LI + FE Sbjct: 370 WGQDCMHWCLPGVPDTWVDILSKLIHDNFE 399 >XP_015892474.1 PREDICTED: protein trichome birefringence-like 12 isoform X1 [Ziziphus jujuba] Length = 401 Score = 67.0 bits (162), Expect = 5e-10 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFET 411 WGQDCMHWCLPGVPDTWVDI+SELIR ET Sbjct: 370 WGQDCMHWCLPGVPDTWVDIVSELIRIGLET 400 >XP_016184602.1 PREDICTED: protein trichome birefringence-like 12 isoform X1 [Arachis ipaensis] Length = 405 Score = 67.0 bits (162), Expect = 6e-10 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIRNRFE 414 WGQDCMHWCLPGVPDTWVDILS+LI + FE Sbjct: 376 WGQDCMHWCLPGVPDTWVDILSKLIHDSFE 405 >OAY39405.1 hypothetical protein MANES_10G092300 [Manihot esculenta] Length = 286 Score = 66.2 bits (160), Expect = 6e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 503 WGQDCMHWCLPGVPDTWVDILSELIR 426 WGQDCMHWCLPGVPDTWVDILSELIR Sbjct: 255 WGQDCMHWCLPGVPDTWVDILSELIR 280