BLASTX nr result
ID: Phellodendron21_contig00029512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029512 (601 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003889719.1 hypothetical protein PGTG_21567 [Puccinia gramini... 92 2e-18 KNF00572.1 hypothetical protein PSTG_06265 [Puccinia striiformis... 92 2e-18 OAV98243.1 hypothetical protein PTTG_00298 [Puccinia triticina 1... 92 3e-18 XP_007411617.1 hypothetical protein MELLADRAFT_72190 [Melampsora... 86 3e-16 KNZ46935.1 hypothetical protein VP01_681g3 [Puccinia sorghi] 84 2e-15 >XP_003889719.1 hypothetical protein PGTG_21567 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EHS63434.1 hypothetical protein PGTG_21567 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 382 Score = 92.0 bits (227), Expect = 2e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +2 Query: 437 YKVESSQVTLKPGQILVYGDSEVSLEEKRARQPRYHAPIAIPDMRLGLP 583 YK+ +SQVTLKPGQ+LVYGD+EVSLEEKRARQPRY APIAIPDMRLGLP Sbjct: 332 YKIVNSQVTLKPGQVLVYGDNEVSLEEKRARQPRYQAPIAIPDMRLGLP 380 >KNF00572.1 hypothetical protein PSTG_06265 [Puccinia striiformis f. sp. tritici PST-78] Length = 389 Score = 92.0 bits (227), Expect = 2e-18 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +2 Query: 437 YKVESSQVTLKPGQILVYGDSEVSLEEKRARQPRYHAPIAIPDMRLGLP 583 YK+ +SQVTLKPGQ+LVYGD+EVSLEEKRARQPRY APIAIPDMRLGLP Sbjct: 339 YKIVNSQVTLKPGQVLVYGDNEVSLEEKRARQPRYQAPIAIPDMRLGLP 387 >OAV98243.1 hypothetical protein PTTG_00298 [Puccinia triticina 1-1 BBBD Race 1] Length = 406 Score = 91.7 bits (226), Expect = 3e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +2 Query: 437 YKVESSQVTLKPGQILVYGDSEVSLEEKRARQPRYHAPIAIPDMRLGLP 583 YK+ +SQVTLKPGQ+LVYGDSEVSLEEKRARQPRY APIA+PDMR GLP Sbjct: 356 YKIANSQVTLKPGQVLVYGDSEVSLEEKRARQPRYQAPIAVPDMRFGLP 404 >XP_007411617.1 hypothetical protein MELLADRAFT_72190 [Melampsora larici-populina 98AG31] EGG05252.1 hypothetical protein MELLADRAFT_72190 [Melampsora larici-populina 98AG31] Length = 364 Score = 85.5 bits (210), Expect = 3e-16 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 437 YKVESSQVTLKPGQILVYGDSEVSLEEKRARQPRYHAPIAIPDMRLGLPR 586 YKVESSQVT K GQ+L+YGD++VS+EEKRARQPRY APIA+PDMRLGL R Sbjct: 315 YKVESSQVTPKAGQLLMYGDTDVSIEEKRARQPRYQAPIAVPDMRLGLSR 364 >KNZ46935.1 hypothetical protein VP01_681g3 [Puccinia sorghi] Length = 485 Score = 84.0 bits (206), Expect = 2e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = +2 Query: 437 YKVESSQVTLKPGQILVYGDSEVSLEEKRARQPRYHAPIAIPDMR 571 YK+ +SQVTLKPGQ+LVYGD+EVSLEEKRARQPRY APIAIPDMR Sbjct: 360 YKIVTSQVTLKPGQVLVYGDNEVSLEEKRARQPRYQAPIAIPDMR 404