BLASTX nr result
ID: Phellodendron21_contig00029510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029510 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006491441.1 PREDICTED: LRR receptor-like serine/threonine-pro... 85 3e-17 >XP_006491441.1 PREDICTED: LRR receptor-like serine/threonine-protein kinase RPK2 [Citrus sinensis] Length = 1129 Score = 85.1 bits (209), Expect = 3e-17 Identities = 43/62 (69%), Positives = 48/62 (77%) Frame = +2 Query: 107 MPRGFQNYNHHIQLHFLVLNKYLYFLVALQIICSSVSVSLADGHGEDKNVLLQLKYAITE 286 MPR Q Y+HH QLH L+LNK L FLV LQIICS ++V+ ADG EDKN LLQLK AITE Sbjct: 1 MPRRSQIYSHHYQLHLLLLNKLLCFLVGLQIICSLLAVASADGLAEDKNALLQLKSAITE 60 Query: 287 DP 292 DP Sbjct: 61 DP 62