BLASTX nr result
ID: Phellodendron21_contig00029456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029456 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417167.1 hypothetical protein MELLADRAFT_94264 [Melampsora... 60 7e-08 >XP_007417167.1 hypothetical protein MELLADRAFT_94264 [Melampsora larici-populina 98AG31] EGF99568.1 hypothetical protein MELLADRAFT_94264 [Melampsora larici-populina 98AG31] Length = 216 Score = 60.5 bits (145), Expect = 7e-08 Identities = 31/73 (42%), Positives = 49/73 (67%) Frame = +1 Query: 346 MDECQESGTRQMLQCRYQPSSTNQQEPLSVQRTEESGTNERLQSKDLAAKTVETPVESGN 525 MDE +E+ RQ+L+ R Q +S+N QEP+SV R +++G E + ++D+ A+T S + Sbjct: 1 MDEEEEAELRQILRSRNQSNSSNWQEPVSVWRNDQTGEIEWIGAEDIPAET----DASSD 56 Query: 526 STPWFVDQPELNP 564 + PWFVD+PE P Sbjct: 57 TNPWFVDEPEPEP 69