BLASTX nr result
ID: Phellodendron21_contig00029419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029419 (302 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007406012.1 hypothetical protein MELLADRAFT_115471 [Melampsor... 70 9e-12 XP_003328845.1 hypothetical protein PGTG_10146 [Puccinia gramini... 57 2e-07 OAV94724.1 hypothetical protein PTTG_03108 [Puccinia triticina 1... 54 2e-06 >XP_007406012.1 hypothetical protein MELLADRAFT_115471 [Melampsora larici-populina 98AG31] EGG10543.1 hypothetical protein MELLADRAFT_115471 [Melampsora larici-populina 98AG31] Length = 1379 Score = 69.7 bits (169), Expect = 9e-12 Identities = 30/52 (57%), Positives = 44/52 (84%) Frame = +3 Query: 3 IIGKGGSGLKMLSEESGGGAVDVIGKSGSDRLSVVGNLEQLEVIRKILSRLV 158 IIG+GG+GL++++EES G +DVIGK GSD LS+ G+LEQLE+++KI+ R + Sbjct: 1323 IIGRGGNGLRIMNEESDGAMIDVIGKVGSDSLSICGSLEQLEIVKKIIIRFI 1374 >XP_003328845.1 hypothetical protein PGTG_10146 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP84426.1 hypothetical protein PGTG_10146 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 1394 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/51 (49%), Positives = 39/51 (76%) Frame = +3 Query: 3 IIGKGGSGLKMLSEESGGGAVDVIGKSGSDRLSVVGNLEQLEVIRKILSRL 155 IIG+GG+GL+ L +SGG V+V+GKSGSD L V+G +QL+ ++ L+++ Sbjct: 1340 IIGRGGNGLRELIAKSGGAVVEVLGKSGSDTLKVIGTSQQLDAVKASLNQI 1390 >OAV94724.1 hypothetical protein PTTG_03108 [Puccinia triticina 1-1 BBBD Race 1] Length = 1395 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/51 (45%), Positives = 40/51 (78%) Frame = +3 Query: 3 IIGKGGSGLKMLSEESGGGAVDVIGKSGSDRLSVVGNLEQLEVIRKILSRL 155 IIG+GG+GL+ L+ +S G V+V+GKSGSD L ++G +QL+ ++ +L+++ Sbjct: 1341 IIGRGGTGLRELTAKSDGAFVEVLGKSGSDTLKIMGTSKQLDSVKALLNQM 1391