BLASTX nr result
ID: Phellodendron21_contig00029360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029360 (298 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403503.1 hypothetical protein MELLADRAFT_86717 [Melampsora... 58 1e-07 >XP_007403503.1 hypothetical protein MELLADRAFT_86717 [Melampsora larici-populina 98AG31] EGG12565.1 hypothetical protein MELLADRAFT_86717 [Melampsora larici-populina 98AG31] Length = 399 Score = 57.8 bits (138), Expect = 1e-07 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = +3 Query: 3 MRRIAKRANVFPIIGRADELTVSQLETVRNWITSELRGQAVDLSV 137 M+RI KR+NV P+IGR+DELT+ QL +R W+ +E++ +DLS+ Sbjct: 188 MKRIGKRSNVLPVIGRSDELTIQQLTNIRTWLRTEMKQSGLDLSL 232