BLASTX nr result
ID: Phellodendron21_contig00029324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029324 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010094003.1 hypothetical protein L484_007349 [Morus notabilis... 57 2e-08 XP_006380064.1 hypothetical protein POPTR_0008s20830g, partial [... 57 6e-08 KMS64590.1 hypothetical protein BVRB_018730 [Beta vulgaris subsp... 54 3e-07 KMS98685.1 hypothetical protein BVRB_3g069950 [Beta vulgaris sub... 54 8e-07 KHN33054.1 hypothetical protein glysoja_010045 [Glycine soja] 53 9e-07 KNA19144.1 hypothetical protein SOVF_064370 [Spinacia oleracea] 52 2e-06 OIV95853.1 hypothetical protein TanjilG_06829 [Lupinus angustifo... 52 2e-06 KHN37581.1 hypothetical protein glysoja_007284 [Glycine soja] KR... 52 2e-06 CDO99005.1 unnamed protein product [Coffea canephora] 52 3e-06 KOM53449.1 hypothetical protein LR48_Vigan09g210800 [Vigna angul... 52 3e-06 XP_007147754.1 hypothetical protein PHAVU_006G152200g [Phaseolus... 52 3e-06 NP_001119251.1 hypothetical protein AT5G19151 [Arabidopsis thali... 52 4e-06 XP_002871865.1 expressed protein [Arabidopsis lyrata subsp. lyra... 52 4e-06 OAY55830.1 hypothetical protein MANES_03G183000 [Manihot esculenta] 54 4e-06 XP_006400474.1 hypothetical protein EUTSA_v10016117mg [Eutrema s... 52 4e-06 KRH11391.1 hypothetical protein GLYMA_15G105200 [Glycine max] 53 4e-06 XP_006289787.1 hypothetical protein CARUB_v10003389mg [Capsella ... 52 4e-06 XP_010546845.1 PREDICTED: uncharacterized protein LOC104818801 i... 51 5e-06 KYP72847.1 hypothetical protein KK1_005450 [Cajanus cajan] 51 6e-06 XP_018471278.1 PREDICTED: uncharacterized protein LOC108842758 [... 51 7e-06 >XP_010094003.1 hypothetical protein L484_007349 [Morus notabilis] EXB55018.1 hypothetical protein L484_007349 [Morus notabilis] Length = 64 Score = 57.0 bits (136), Expect = 2e-08 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKAXXXXXXXXXXXXNSSTSTPEQSS 210 NA+RSG+VVVG +AFGYL+L LGFKPF+ KA +SS++ PE SS Sbjct: 8 NAMRSGVVVVGAMAFGYLTLYLGFKPFLEKAQLSVEHSQSQPSSSSSNYPESSS 61 >XP_006380064.1 hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] ERP57861.1 hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] Length = 92 Score = 56.6 bits (135), Expect = 6e-08 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKAXXXXXXXXXXXXNSSTSTPEQ 204 NAIRSGIVV+G LAFGYL+L++GFKPF+LKA + TS +Q Sbjct: 36 NAIRSGIVVIGALAFGYLTLQIGFKPFLLKAQQHEEQQQQSLHSQETSINDQ 87 >KMS64590.1 hypothetical protein BVRB_018730 [Beta vulgaris subsp. vulgaris] Length = 73 Score = 54.3 bits (129), Expect = 3e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSG+VVVG LAFGYL+L++GFKPF+LKA Sbjct: 8 NAMRSGLVVVGALAFGYLTLQIGFKPFLLKA 38 >KMS98685.1 hypothetical protein BVRB_3g069950 [Beta vulgaris subsp. vulgaris] Length = 82 Score = 53.5 bits (127), Expect = 8e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSG+VVVG LAFGYL+L++GFKPF++KA Sbjct: 8 NAMRSGLVVVGALAFGYLTLQIGFKPFLIKA 38 >KHN33054.1 hypothetical protein glysoja_010045 [Glycine soja] Length = 59 Score = 52.8 bits (125), Expect = 9e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYLS+E+GFKP++ KA Sbjct: 4 NAIRSGIVVLGALAFGYLSIEIGFKPYLEKA 34 >KNA19144.1 hypothetical protein SOVF_064370 [Spinacia oleracea] Length = 80 Score = 52.4 bits (124), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSG+VVVG LAFGYL+L+LGFKPF+ KA Sbjct: 13 NAMRSGLVVVGALAFGYLNLQLGFKPFLEKA 43 >OIV95853.1 hypothetical protein TanjilG_06829 [Lupinus angustifolius] Length = 82 Score = 52.4 bits (124), Expect = 2e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSGI+VVG LAFGYLSL++GFKP++ KA Sbjct: 10 NAVRSGIIVVGALAFGYLSLQIGFKPYLDKA 40 >KHN37581.1 hypothetical protein glysoja_007284 [Glycine soja] KRH20890.1 hypothetical protein GLYMA_13G207400 [Glycine max] Length = 68 Score = 52.0 bits (123), Expect = 2e-06 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKAXXXXXXXXXXXXN---SSTSTPEQSS 210 NAIRSGIVV+G LAFGYLS+++GFKP++ KA + SS++ PE++S Sbjct: 12 NAIRSGIVVLGALAFGYLSIQIGFKPYLEKAQNQNALYESDPSSQEESSSAFPERTS 68 >CDO99005.1 unnamed protein product [Coffea canephora] Length = 64 Score = 51.6 bits (122), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSG+VV+G LAFGYL+L+LGFKPF+ KA Sbjct: 8 NAMRSGVVVLGALAFGYLTLQLGFKPFLEKA 38 >KOM53449.1 hypothetical protein LR48_Vigan09g210800 [Vigna angularis] Length = 67 Score = 51.6 bits (122), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYLS+++GFKP++ KA Sbjct: 12 NAIRSGIVVLGTLAFGYLSIQIGFKPYLEKA 42 >XP_007147754.1 hypothetical protein PHAVU_006G152200g [Phaseolus vulgaris] ESW19748.1 hypothetical protein PHAVU_006G152200g [Phaseolus vulgaris] Length = 67 Score = 51.6 bits (122), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYLS+++GFKP++ KA Sbjct: 12 NAIRSGIVVLGTLAFGYLSIQIGFKPYLEKA 42 >NP_001119251.1 hypothetical protein AT5G19151 [Arabidopsis thaliana] AED92662.1 hypothetical protein AT5G19151 [Arabidopsis thaliana] Length = 74 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRS +VV+G LAFGYLSLELG+KPF+ KA Sbjct: 8 NAIRSSVVVLGSLAFGYLSLELGYKPFLEKA 38 >XP_002871865.1 expressed protein [Arabidopsis lyrata subsp. lyrata] EFH48124.1 expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 74 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRS +VV+G LAFGYLSLELG+KPF+ KA Sbjct: 8 NAIRSSVVVLGSLAFGYLSLELGYKPFLEKA 38 >OAY55830.1 hypothetical protein MANES_03G183000 [Manihot esculenta] Length = 211 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYL+LE+GFKPF+ KA Sbjct: 8 NAIRSGIVVIGALAFGYLTLEIGFKPFLHKA 38 >XP_006400474.1 hypothetical protein EUTSA_v10016117mg [Eutrema salsugineum] ESQ41927.1 hypothetical protein EUTSA_v10016117mg [Eutrema salsugineum] Length = 76 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRS +VV+G LAFGYLSLELG+KPF+ KA Sbjct: 8 NAIRSSVVVLGSLAFGYLSLELGYKPFLEKA 38 >KRH11391.1 hypothetical protein GLYMA_15G105200 [Glycine max] Length = 123 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYLS+E+GFKP++ KA Sbjct: 68 NAIRSGIVVLGALAFGYLSIEIGFKPYLEKA 98 >XP_006289787.1 hypothetical protein CARUB_v10003389mg [Capsella rubella] EOA22685.1 hypothetical protein CARUB_v10003389mg [Capsella rubella] Length = 78 Score = 51.6 bits (122), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRS +VV+G LAFGYLSLELG+KPF+ KA Sbjct: 8 NAIRSSVVVLGSLAFGYLSLELGYKPFLEKA 38 >XP_010546845.1 PREDICTED: uncharacterized protein LOC104818801 isoform X2 [Tarenaya hassleriana] Length = 75 Score = 51.2 bits (121), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NA+RSG+VV+G LAFGYLSL+LGFKPF+ +A Sbjct: 8 NAMRSGVVVLGSLAFGYLSLQLGFKPFLDRA 38 >KYP72847.1 hypothetical protein KK1_005450 [Cajanus cajan] Length = 68 Score = 50.8 bits (120), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRSGIVV+G LAFGYLS+ +GFKP++ KA Sbjct: 12 NAIRSGIVVLGALAFGYLSIRIGFKPYLEKA 42 >XP_018471278.1 PREDICTED: uncharacterized protein LOC108842758 [Raphanus sativus] Length = 75 Score = 50.8 bits (120), Expect = 7e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 49 NAIRSGIVVVGFLAFGYLSLELGFKPFILKA 141 NAIRS +VV+G LAFGY+SLELG+KPF+ KA Sbjct: 8 NAIRSSVVVLGSLAFGYMSLELGYKPFLEKA 38