BLASTX nr result
ID: Phellodendron21_contig00029127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029127 (458 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019153415.1 PREDICTED: biotin carboxyl carrier protein of ace... 97 7e-22 XP_018815637.1 PREDICTED: biotin carboxyl carrier protein of ace... 96 3e-21 CAA62262.1 biotin carboxyl carrier protein, partial (macronuclea... 91 3e-21 XP_018815636.1 PREDICTED: biotin carboxyl carrier protein of ace... 96 4e-21 OAY34224.1 hypothetical protein MANES_12G004000 [Manihot esculenta] 96 4e-21 KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimo... 93 5e-21 AGH32912.1 biotin carboxyl carrier protein subunit [Camellia che... 96 5e-21 XP_019193945.1 PREDICTED: biotin carboxyl carrier protein of ace... 95 9e-21 XP_019442212.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 9e-21 CBI22298.3 unnamed protein product, partial [Vitis vinifera] 89 9e-21 XP_017621479.1 PREDICTED: uncharacterized protein LOC108465615 [... 91 1e-20 OAY32261.1 hypothetical protein MANES_13G004100 [Manihot esculenta] 95 1e-20 XP_016506332.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 1e-20 XP_009775160.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 1e-20 KJB66288.1 hypothetical protein B456_010G135200 [Gossypium raimo... 93 1e-20 KJB81167.1 hypothetical protein B456_013G132300 [Gossypium raimo... 94 1e-20 XP_011013434.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 1e-20 XP_004304236.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 1e-20 NP_001234322.1 biotin carboxylase carrier protein [Solanum lycop... 94 2e-20 XP_006345777.1 PREDICTED: biotin carboxyl carrier protein of ace... 94 2e-20 >XP_019153415.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Ipomoea nil] Length = 263 Score = 97.4 bits (241), Expect = 7e-22 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTIVEIVAEDGK VSVDTPLFVIAP Sbjct: 213 DKVQKGQVICIIEAMKLMNEIEADQSGTIVEIVAEDGKPVSVDTPLFVIAP 263 >XP_018815637.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic isoform X2 [Juglans regia] Length = 263 Score = 95.9 bits (237), Expect = 3e-21 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTI+EIVAEDGK VSVDTPLFVI P Sbjct: 213 DKVQKGQVLCIIEAMKLMNEIEADQSGTIIEIVAEDGKPVSVDTPLFVIEP 263 >CAA62262.1 biotin carboxyl carrier protein, partial (macronuclear) [Brassica napus] prf||2210244B Ac-CoA carboxylase:ISOTYPE=bp2 Length = 68 Score = 90.5 bits (223), Expect = 3e-21 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCI+EAMKLMNEIE+DQ+GT+V+IVAEDGK VS+DTPLFV+ P Sbjct: 18 DKVQKGQVLCIVEAMKLMNEIESDQTGTVVDIVAEDGKPVSLDTPLFVVQP 68 >XP_018815636.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Juglans regia] Length = 279 Score = 95.9 bits (237), Expect = 4e-21 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTI+EIVAEDGK VSVDTPLFVI P Sbjct: 229 DKVQKGQVLCIIEAMKLMNEIEADQSGTIIEIVAEDGKPVSVDTPLFVIEP 279 >OAY34224.1 hypothetical protein MANES_12G004000 [Manihot esculenta] Length = 286 Score = 95.9 bits (237), Expect = 4e-21 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+AEDGK VSVDTPLFVI P Sbjct: 236 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIIAEDGKPVSVDTPLFVIEP 286 >KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 92.8 bits (229), Expect = 5e-21 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+AEDGK VSVD PLFVI P Sbjct: 111 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKAVSVDMPLFVIEP 161 >AGH32912.1 biotin carboxyl carrier protein subunit [Camellia chekiangoleosa] Length = 283 Score = 95.5 bits (236), Expect = 5e-21 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGT+VEI+AEDGK VSVDTPLFVI P Sbjct: 233 DKVQKGQVLCIIEAMKLMNEIEADQSGTVVEIIAEDGKPVSVDTPLFVIEP 283 >XP_019193945.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic [Ipomoea nil] Length = 290 Score = 95.1 bits (235), Expect = 9e-21 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+AEDGK VSVDTPLFVI P Sbjct: 240 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFVIKP 290 >XP_019442212.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like, partial [Lupinus angustifolius] Length = 236 Score = 94.0 bits (232), Expect = 9e-21 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTI EI+AEDGK VSVDTPLFVI P Sbjct: 186 DKVQKGQVICIIEAMKLMNEIEADQSGTIAEIIAEDGKPVSVDTPLFVIVP 236 >CBI22298.3 unnamed protein product, partial [Vitis vinifera] Length = 71 Score = 89.4 bits (220), Expect = 9e-21 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTI EI+AEDGK VS+D PL VIAP Sbjct: 21 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVSIDRPLLVIAP 71 >XP_017621479.1 PREDICTED: uncharacterized protein LOC108465615 [Gossypium arboreum] Length = 126 Score = 90.9 bits (224), Expect = 1e-20 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+ EDGK VSV TPLFVI P Sbjct: 76 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILVEDGKAVSVGTPLFVIEP 126 >OAY32261.1 hypothetical protein MANES_13G004100 [Manihot esculenta] Length = 283 Score = 94.7 bits (234), Expect = 1e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTIVEI+AEDGK VSVDTPLFVI P Sbjct: 233 DKVQKGQVVCIIEAMKLMNEIEADQSGTIVEIIAEDGKPVSVDTPLFVIEP 283 >XP_016506332.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Nicotiana tabacum] Length = 267 Score = 94.4 bits (233), Expect = 1e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGT+VE+VAEDGK VSVDTPLF+I P Sbjct: 217 DKVQKGQVICIIEAMKLMNEIEADQSGTVVEVVAEDGKPVSVDTPLFIIEP 267 >XP_009775160.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Nicotiana sylvestris] Length = 267 Score = 94.4 bits (233), Expect = 1e-20 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGT+VE+VAEDGK VSVDTPLF+I P Sbjct: 217 DKVQKGQVICIIEAMKLMNEIEADQSGTVVEVVAEDGKPVSVDTPLFIIEP 267 >KJB66288.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 201 Score = 92.8 bits (229), Expect = 1e-20 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+AEDGK VSVD PLFVI P Sbjct: 151 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKAVSVDMPLFVIEP 201 >KJB81167.1 hypothetical protein B456_013G132300 [Gossypium raimondii] Length = 243 Score = 93.6 bits (231), Expect = 1e-20 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEI+ EDGK VSVDTPLFVI P Sbjct: 193 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILVEDGKAVSVDTPLFVIEP 243 >XP_011013434.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Populus euphratica] Length = 281 Score = 94.4 bits (233), Expect = 1e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTI EI+AEDGK VSVDTPLFVIAP Sbjct: 231 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVSVDTPLFVIAP 281 >XP_004304236.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Fragaria vesca subsp. vesca] Length = 281 Score = 94.4 bits (233), Expect = 1e-20 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQV+CIIEAMKLMNEIEADQSGTIVE++AED K VSVDTPLFVIAP Sbjct: 231 DKVQKGQVICIIEAMKLMNEIEADQSGTIVEVIAEDAKPVSVDTPLFVIAP 281 >NP_001234322.1 biotin carboxylase carrier protein [Solanum lycopersicum] AAO66472.1 biotin carboxylase carrier protein [Solanum lycopersicum] Length = 285 Score = 94.4 bits (233), Expect = 2e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEAD+SGTIVE+VAEDGK VSVDTPLFVI P Sbjct: 235 DKVQKGQVLCIIEAMKLMNEIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285 >XP_006345777.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 285 Score = 94.4 bits (233), Expect = 2e-20 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = -3 Query: 456 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEIVAEDGKHVSVDTPLFVIAP 304 DKVQKGQVLCIIEAMKLMNEIEAD+SGTIVE+VAEDGK VSVDTPLFVI P Sbjct: 235 DKVQKGQVLCIIEAMKLMNEIEADRSGTIVEVVAEDGKPVSVDTPLFVIKP 285