BLASTX nr result
ID: Phellodendron21_contig00029111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00029111 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV50606.1 hypothetical protein F511_14609 [Dorcoceras hygrometr... 55 7e-07 XP_016578681.1 PREDICTED: 60S ribosomal protein L37-3 [Capsicum ... 54 1e-06 XP_009611259.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana... 54 1e-06 XP_004241731.1 PREDICTED: 60S ribosomal protein L37-2 [Solanum l... 54 1e-06 XP_019194032.1 PREDICTED: 60S ribosomal protein L37-3 [Ipomoea n... 54 1e-06 XP_019448155.1 PREDICTED: 60S ribosomal protein L37-3 [Lupinus a... 54 1e-06 XP_018840840.1 PREDICTED: 60S ribosomal protein L37-3 [Juglans r... 54 1e-06 KZV26089.1 hypothetical protein F511_06015 [Dorcoceras hygrometr... 54 1e-06 XP_012852830.1 PREDICTED: 60S ribosomal protein L37-3 [Erythrant... 54 1e-06 XP_012856774.1 PREDICTED: 60S ribosomal protein L37-3 [Erythrant... 54 1e-06 EPS70838.1 hypothetical protein M569_03921, partial [Genlisea au... 54 1e-06 KZV56102.1 hypothetical protein F511_06119 [Dorcoceras hygrometr... 54 2e-06 EPS74476.1 hypothetical protein M569_00287, partial [Genlisea au... 54 2e-06 EPS63391.1 hypothetical protein M569_11398, partial [Genlisea au... 54 2e-06 XP_018837499.1 PREDICTED: 60S ribosomal protein L37-3-like [Jugl... 53 3e-06 XP_011072354.1 PREDICTED: 60S ribosomal protein L37-3 [Sesamum i... 53 3e-06 XP_011080793.1 PREDICTED: 60S ribosomal protein L37-3 [Sesamum i... 53 3e-06 XP_006426971.1 hypothetical protein CICLE_v10026841mg [Citrus cl... 53 3e-06 XP_016742582.1 PREDICTED: 60S ribosomal protein L37-3-like [Goss... 53 4e-06 XP_016562668.1 PREDICTED: 60S ribosomal protein L37-3 [Capsicum ... 53 4e-06 >KZV50606.1 hypothetical protein F511_14609 [Dorcoceras hygrometricum] Length = 95 Score = 54.7 bits (130), Expect = 7e-07 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLCI HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_016578681.1 PREDICTED: 60S ribosomal protein L37-3 [Capsicum annuum] Length = 94 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_009611259.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tomentosiformis] XP_009777906.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana sylvestris] XP_016479170.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tabacum] XP_016503601.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tabacum] XP_019262302.1 PREDICTED: 60S ribosomal protein L37-3 [Nicotiana attenuata] OIT37906.1 60s ribosomal protein l37-3 [Nicotiana attenuata] Length = 94 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_004241731.1 PREDICTED: 60S ribosomal protein L37-2 [Solanum lycopersicum] XP_006356156.1 PREDICTED: 60S ribosomal protein L37-2 [Solanum tuberosum] XP_015079129.1 PREDICTED: 60S ribosomal protein L37-2 [Solanum pennellii] Length = 94 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_019194032.1 PREDICTED: 60S ribosomal protein L37-3 [Ipomoea nil] XP_019196902.1 PREDICTED: 60S ribosomal protein L37-3 [Ipomoea nil] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_019448155.1 PREDICTED: 60S ribosomal protein L37-3 [Lupinus angustifolius] OIW09097.1 hypothetical protein TanjilG_16324 [Lupinus angustifolius] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_018840840.1 PREDICTED: 60S ribosomal protein L37-3 [Juglans regia] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >KZV26089.1 hypothetical protein F511_06015 [Dorcoceras hygrometricum] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_012852830.1 PREDICTED: 60S ribosomal protein L37-3 [Erythranthe guttata] EYU24699.1 hypothetical protein MIMGU_mgv1a017069mg [Erythranthe guttata] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >XP_012856774.1 PREDICTED: 60S ribosomal protein L37-3 [Erythranthe guttata] EYU21452.1 hypothetical protein MIMGU_mgv1a017055mg [Erythranthe guttata] Length = 95 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >EPS70838.1 hypothetical protein M569_03921, partial [Genlisea aurea] Length = 93 Score = 53.9 bits (128), Expect = 1e-06 Identities = 30/46 (65%), Positives = 32/46 (69%), Gaps = 8/46 (17%) Frame = -1 Query: 472 GKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 GKGTGSFGKRRNKTHTLCI HL S+ S YP ARKRT+ Sbjct: 1 GKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARKRTY 46 >KZV56102.1 hypothetical protein F511_06119 [Dorcoceras hygrometricum] Length = 121 Score = 54.3 bits (129), Expect = 2e-06 Identities = 29/47 (61%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 47 >EPS74476.1 hypothetical protein M569_00287, partial [Genlisea aurea] Length = 94 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 8/46 (17%) Frame = -1 Query: 472 GKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 46 >EPS63391.1 hypothetical protein M569_11398, partial [Genlisea aurea] Length = 94 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/46 (63%), Positives = 32/46 (69%), Gaps = 8/46 (17%) Frame = -1 Query: 472 GKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKRT+ Sbjct: 1 GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTY 46 >XP_018837499.1 PREDICTED: 60S ribosomal protein L37-3-like [Juglans regia] Length = 95 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQ---DSYPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ +YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTY 47 >XP_011072354.1 PREDICTED: 60S ribosomal protein L37-3 [Sesamum indicum] Length = 95 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQ---DSYPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ +YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTY 47 >XP_011080793.1 PREDICTED: 60S ribosomal protein L37-3 [Sesamum indicum] Length = 95 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQ---DSYPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ +YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTY 47 >XP_006426971.1 hypothetical protein CICLE_v10026841mg [Citrus clementina] XP_006465606.1 PREDICTED: 60S ribosomal protein L37-3 [Citrus sinensis] ESR40211.1 hypothetical protein CICLE_v10026841mg [Citrus clementina] KDO56887.1 hypothetical protein CISIN_1g034400mg [Citrus sinensis] Length = 95 Score = 53.1 bits (126), Expect = 3e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQ---DSYPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ +YP ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTY 47 >XP_016742582.1 PREDICTED: 60S ribosomal protein L37-3-like [Gossypium hirsutum] XP_017622309.1 PREDICTED: 60S ribosomal protein L37-3-like [Gossypium arboreum] Length = 95 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S +P ARKRT+ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTY 47 >XP_016562668.1 PREDICTED: 60S ribosomal protein L37-3 [Capsicum annuum] Length = 95 Score = 52.8 bits (125), Expect = 4e-06 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 8/47 (17%) Frame = -1 Query: 475 LGKGTGSFGKRRNKTHTLCILS-----HLPSSQDS---YPIARKRTW 359 +GKGTGSFGKRRNKTHTLC+ HL S+ S YP ARKR++ Sbjct: 1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRSY 47