BLASTX nr result
ID: Phellodendron21_contig00028966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028966 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006422226.1 hypothetical protein CICLE_v10004575mg [Citrus cl... 64 5e-09 >XP_006422226.1 hypothetical protein CICLE_v10004575mg [Citrus clementina] XP_006422227.1 hypothetical protein CICLE_v10004575mg [Citrus clementina] XP_006475326.1 PREDICTED: cyclin-T1-3-like [Citrus sinensis] ESR35466.1 hypothetical protein CICLE_v10004575mg [Citrus clementina] ESR35467.1 hypothetical protein CICLE_v10004575mg [Citrus clementina] Length = 605 Score = 63.9 bits (154), Expect = 5e-09 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = +2 Query: 2 ERAPEXXXXXXXXXXXXXXNYDYVEDRNKMSRTGWDHKRHVPENHV 139 ER PE NYDY++DRNKMSR GWDH+RH+PENHV Sbjct: 560 ERGPEGRPRQSYGLGSHHHNYDYIDDRNKMSRVGWDHRRHIPENHV 605