BLASTX nr result
ID: Phellodendron21_contig00028857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028857 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010098190.1 hypothetical protein L484_007652 [Morus notabilis... 62 1e-10 OMO67464.1 hypothetical protein CCACVL1_20506 [Corchorus capsula... 59 2e-09 XP_009786070.1 PREDICTED: uncharacterized protein LOC104234228 [... 58 4e-09 GAU15647.1 hypothetical protein TSUD_109050 [Trifolium subterran... 57 7e-09 XP_003597237.1 hypothetical protein MTR_2g094290 [Medicago trunc... 56 2e-08 OMO72506.1 hypothetical protein CCACVL1_17750 [Corchorus capsula... 52 6e-07 AEI61928.1 DBP1-interacting protein 2 [Nicotiana tabacum] 52 6e-07 OIS96283.1 hypothetical protein A4A49_49316 [Nicotiana attenuata] 51 2e-06 >XP_010098190.1 hypothetical protein L484_007652 [Morus notabilis] EXB74646.1 hypothetical protein L484_007652 [Morus notabilis] Length = 55 Score = 61.6 bits (148), Expect = 1e-10 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +3 Query: 186 MAKDL-RHMMKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDED 326 MA L RH+MKPWIEVAP LLDFP K S P LETI E ERAEE D+D Sbjct: 1 MANQLFRHVMKPWIEVAPVLLDFPWKCSVCPKLETIVE-ERAEECDDD 47 >OMO67464.1 hypothetical protein CCACVL1_20506 [Corchorus capsularis] OMO91498.1 hypothetical protein COLO4_18334 [Corchorus olitorius] Length = 51 Score = 58.5 bits (140), Expect = 2e-09 Identities = 25/44 (56%), Positives = 37/44 (84%) Frame = +3 Query: 192 KDLRHMMKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDE 323 ++++ MMKPWIE +P L+ FP++ S+AP LETI+E ERAEEH++ Sbjct: 4 REVKQMMKPWIEASPALIGFPLRPSNAPKLETIRE-ERAEEHED 46 >XP_009786070.1 PREDICTED: uncharacterized protein LOC104234228 [Nicotiana sylvestris] Length = 58 Score = 57.8 bits (138), Expect = 4e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = +3 Query: 177 EIAMAKDLRHMMKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDED 326 ++ MAK + +M KPWIEVAP L+ P K+S +P LETIKED+RAE +ED Sbjct: 4 KVKMAKKVVNM-KPWIEVAPPLVISPTKLSHSPKLETIKEDDRAEGQNED 52 >GAU15647.1 hypothetical protein TSUD_109050 [Trifolium subterraneum] Length = 50 Score = 57.0 bits (136), Expect = 7e-09 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +3 Query: 186 MAKDLRHMMKPWI-EVAPKLLDFPMKISSAPSLETIKEDERAEE 314 MA++LR MKPWI EVAP LL+FP K S+ P LETI EDE EE Sbjct: 1 MARELRPAMKPWIVEVAPSLLEFPWKPSNTPKLETIFEDEECEE 44 >XP_003597237.1 hypothetical protein MTR_2g094290 [Medicago truncatula] AES67488.1 hypothetical protein MTR_2g094290 [Medicago truncatula] Length = 50 Score = 55.8 bits (133), Expect = 2e-08 Identities = 28/44 (63%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +3 Query: 186 MAKDLRHM-MKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEE 314 MA++LR MKPW+EVAP LL+FP K S+ P LETI EDE EE Sbjct: 1 MARELRPATMKPWMEVAPSLLEFPWKPSNTPKLETIFEDEECEE 44 >OMO72506.1 hypothetical protein CCACVL1_17750 [Corchorus capsularis] OMO73542.1 hypothetical protein COLO4_27027 [Corchorus olitorius] Length = 47 Score = 52.0 bits (123), Expect = 6e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 186 MAKDLRHMMKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDED 326 MAK++R++ WIEVAP LL P+K S++P LETI E+E EE D+D Sbjct: 1 MAKEVRYLSS-WIEVAPALLISPLKTSNSPVLETITEEEADEESDDD 46 >AEI61928.1 DBP1-interacting protein 2 [Nicotiana tabacum] Length = 52 Score = 52.0 bits (123), Expect = 6e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 210 MKPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDED 326 MKP IEVAP L+ FP K+S P LETIKED+R E +ED Sbjct: 8 MKPCIEVAPPLVIFPTKLSHFPKLETIKEDDRVEGQNED 46 >OIS96283.1 hypothetical protein A4A49_49316 [Nicotiana attenuata] Length = 70 Score = 51.2 bits (121), Expect = 2e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +3 Query: 213 KPWIEVAPKLLDFPMKISSAPSLETIKEDERAEEHDED 326 KPWIEVAP L+ P K+S LETIKED RAEE +ED Sbjct: 27 KPWIEVAPPLVVSPTKLSHFSKLETIKEDYRAEEKNED 64