BLASTX nr result
ID: Phellodendron21_contig00028852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028852 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006435816.1 hypothetical protein CICLE_v10032369mg [Citrus cl... 57 8e-07 >XP_006435816.1 hypothetical protein CICLE_v10032369mg [Citrus clementina] XP_006486247.1 PREDICTED: uncharacterized protein LOC102610808 [Citrus sinensis] ESR49056.1 hypothetical protein CICLE_v10032369mg [Citrus clementina] Length = 275 Score = 57.0 bits (136), Expect = 8e-07 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 16/49 (32%) Frame = -2 Query: 446 LGVRGLH----------------NFFASLVRRFRGPSEGHRSTYSRVNF 348 LG+ GLH NFFAS VRRFRGPSEGHRSTYSR+NF Sbjct: 227 LGIHGLHALPNLDFWGSILHRMQNFFASFVRRFRGPSEGHRSTYSRINF 275