BLASTX nr result
ID: Phellodendron21_contig00028786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028786 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007403640.1 hypothetical protein MELLADRAFT_30094 [Melampsora... 84 9e-19 XP_003333832.1 hypothetical protein PGTG_15255 [Puccinia gramini... 75 4e-14 KNF01942.1 hypothetical protein PSTG_04767 [Puccinia striiformis... 75 1e-13 KNZ45486.1 hypothetical protein VP01_807g16 [Puccinia sorghi] 69 9e-12 OAV95021.1 hypothetical protein PTTG_26782 [Puccinia triticina 1... 52 6e-06 >XP_007403640.1 hypothetical protein MELLADRAFT_30094 [Melampsora larici-populina 98AG31] EGG12702.1 hypothetical protein MELLADRAFT_30094, partial [Melampsora larici-populina 98AG31] Length = 95 Score = 83.6 bits (205), Expect = 9e-19 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +3 Query: 192 RNLEFRFRNYDPTIQGPRRHDPVVHQPDTVEETVKDVMDRVRTEDELRRAG 344 R LEFRFRNYDPTIQGPRRHDP +Q DTVEE VKDVM++VR EDE+RR+G Sbjct: 1 RKLEFRFRNYDPTIQGPRRHDP-SNQTDTVEERVKDVMEQVRIEDEIRRSG 50 >XP_003333832.1 hypothetical protein PGTG_15255 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP89413.1 hypothetical protein PGTG_15255 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 240 Score = 75.1 bits (183), Expect = 4e-14 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 186 RARNLEFRFRNYDPTIQGPRRHDPVVHQPDTVEETVKDVMDRVRTEDELRRA 341 +A+ EF+FRNYDPTIQGP+RHDP H +TVEETVKD+M++V+ DE R+ Sbjct: 106 KAKKREFKFRNYDPTIQGPKRHDPSEHSKETVEETVKDLMEKVKQNDEAIRS 157 >KNF01942.1 hypothetical protein PSTG_04767 [Puccinia striiformis f. sp. tritici PST-78] Length = 372 Score = 75.5 bits (184), Expect = 1e-13 Identities = 32/52 (61%), Positives = 43/52 (82%) Frame = +3 Query: 186 RARNLEFRFRNYDPTIQGPRRHDPVVHQPDTVEETVKDVMDRVRTEDELRRA 341 +A+ EF+FRNYDP IQGP+RHDPV H +TVEETVKD+M++V+ DE+ R+ Sbjct: 238 KAKKREFKFRNYDPIIQGPKRHDPVEHSKETVEETVKDLMEQVKQNDEVIRS 289 >KNZ45486.1 hypothetical protein VP01_807g16 [Puccinia sorghi] Length = 221 Score = 68.6 bits (166), Expect = 9e-12 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = +3 Query: 189 ARNLEFRFRNYDPTIQGPRRHDPVVHQPDTVEETVKDVMDRVRTEDELRRA 341 ++ EFRFRNYDPTI GP+RHDP +H +TVEE VKD++ V DE+ RA Sbjct: 89 SKKREFRFRNYDPTINGPKRHDPSLHAQETVEEKVKDLVANVTASDEIIRA 139 >OAV95021.1 hypothetical protein PTTG_26782 [Puccinia triticina 1-1 BBBD Race 1] Length = 151 Score = 52.0 bits (123), Expect = 6e-06 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = +3 Query: 237 GPRRHDPVVHQPDTVEETVKDVMDRVRTEDELRRA 341 GP+RHDPV H +TVEETVKD+M++V+ DE+ R+ Sbjct: 35 GPKRHDPVEHSKETVEETVKDIMEKVKQNDEVIRS 69