BLASTX nr result
ID: Phellodendron21_contig00028740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028740 (566 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409594.1 hypothetical protein MELLADRAFT_86061 [Melampsora... 106 5e-27 XP_003331766.1 hypothetical protein PGTG_13575 [Puccinia gramini... 101 4e-25 KNZ62596.1 hypothetical protein VP01_1250g11 [Puccinia sorghi] 96 1e-22 OAV86621.1 hypothetical protein PTTG_10675, partial [Puccinia tr... 91 6e-21 KNE94597.1 hypothetical protein PSTG_12061 [Puccinia striiformis... 88 1e-19 OCB88043.1 hypothetical protein A7U60_g4828 [Sanghuangporus baumii] 77 2e-15 KIK28021.1 hypothetical protein PISMIDRAFT_674361 [Pisolithus mi... 75 7e-15 XP_007763944.1 hypothetical protein CONPUDRAFT_96915 [Coniophora... 75 7e-15 KZT44027.1 ATPase, F0 complex, subunit J [Sistotremastrum suecic... 75 1e-14 KIO09949.1 hypothetical protein M404DRAFT_995931 [Pisolithus tin... 75 1e-14 KIM54716.1 hypothetical protein SCLCIDRAFT_344482 [Scleroderma c... 75 1e-14 EPS93034.1 hypothetical protein FOMPIDRAFT_1033850 [Fomitopsis p... 74 1e-14 XP_007267554.1 hypothetical protein FOMMEDRAFT_51366, partial [F... 72 7e-14 KZV71955.1 hypothetical protein PENSPDRAFT_378862 [Peniophora sp... 72 1e-13 KIM54223.1 hypothetical protein SCLCIDRAFT_1222188 [Scleroderma ... 72 1e-13 KIK79424.1 hypothetical protein PAXRUDRAFT_161335 [Paxillus rubi... 72 1e-13 KZT00052.1 hypothetical protein LAESUDRAFT_732643 [Laetiporus su... 70 4e-13 XP_013243276.1 putative ATP18-subunit I/j of the mitochondrial F... 70 4e-13 XP_007863152.1 hypothetical protein GLOTRDRAFT_71680 [Gloeophyll... 70 4e-13 XP_016269211.1 F-type H+-transporting ATPase subunit j [Rhodotor... 70 6e-13 >XP_007409594.1 hypothetical protein MELLADRAFT_86061 [Melampsora larici-populina 98AG31] EGG07152.1 hypothetical protein MELLADRAFT_86061 [Melampsora larici-populina 98AG31] Length = 59 Score = 106 bits (264), Expect = 5e-27 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPF 237 MSFFGLRAWPTPVWKPMSHFI+GG +TFYL+NK QNSMLAS TYAKDPRNPF Sbjct: 1 MSFFGLRAWPTPVWKPMSHFILGGAVTFYLINKVQNSMLASPTYAKDPRNPF 52 >XP_003331766.1 hypothetical protein PGTG_13575 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP87347.1 hypothetical protein PGTG_13575 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 57 Score = 101 bits (251), Expect = 4e-25 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKK 249 MSFFG+RAWPTPVWKPMSHF+IGG +TFYLVNK QN+ML S YAKDPRNP A +K Sbjct: 1 MSFFGVRAWPTPVWKPMSHFMIGGAITFYLVNKMQNAMLKSPEYAKDPRNPHAARK 56 >KNZ62596.1 hypothetical protein VP01_1250g11 [Puccinia sorghi] Length = 105 Score = 96.3 bits (238), Expect = 1e-22 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 70 KRIEMSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNP 234 K+ MSFFG+RAWPTPV+KPMSHFI+GG +TFYLVNK QN+ML S YAKDPRNP Sbjct: 38 KQATMSFFGVRAWPTPVFKPMSHFIVGGAITFYLVNKMQNAMLKSPVYAKDPRNP 92 >OAV86621.1 hypothetical protein PTTG_10675, partial [Puccinia triticina 1-1 BBBD Race 1] Length = 51 Score = 90.5 bits (223), Expect = 6e-21 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +1 Query: 85 SFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNP 234 SFFG+RAWPTPV++PMSHF+IGG +TFYLVNK QN+ML S YAKDPRNP Sbjct: 1 SFFGVRAWPTPVFRPMSHFMIGGAITFYLVNKMQNAMLKSPDYAKDPRNP 50 >KNE94597.1 hypothetical protein PSTG_12061 [Puccinia striiformis f. sp. tritici PST-78] Length = 72 Score = 87.8 bits (216), Expect = 1e-19 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNP 234 M+FFG+RAWPTPV KPMSHF+IGG +TFYLVNK Q +ML S YAKDPRNP Sbjct: 1 MTFFGVRAWPTPVLKPMSHFMIGGVITFYLVNKMQTAMLKSPEYAKDPRNP 51 >OCB88043.1 hypothetical protein A7U60_g4828 [Sanghuangporus baumii] Length = 91 Score = 77.4 bits (189), Expect = 2e-15 Identities = 36/67 (53%), Positives = 47/67 (70%), Gaps = 3/67 (4%) Frame = +1 Query: 73 RIEMSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFA---G 243 ++ M+FFGLR WPTPV KPM+ FI +TFYLV+ Q+ + SETYA DP+NP+A Sbjct: 24 KLTMAFFGLRKWPTPVLKPMAPFIAASAVTFYLVSSLQDMAVRSETYANDPKNPYAAQIA 83 Query: 244 KKGAAGH 264 K+ AA H Sbjct: 84 KEKAAAH 90 >KIK28021.1 hypothetical protein PISMIDRAFT_674361 [Pisolithus microcarpus 441] Length = 62 Score = 75.1 bits (183), Expect = 7e-15 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F GLR WPTPV +PM+ FI G+TFYLV Q+ + SETYAKDP+NP+A + Sbjct: 1 MAFLGLRKWPTPVLRPMAPFIAASGITFYLVKTMQDMGVRSETYAKDPKNPYAAQIAREA 60 Query: 262 H 264 H Sbjct: 61 H 61 >XP_007763944.1 hypothetical protein CONPUDRAFT_96915 [Coniophora puteana RWD-64-598 SS2] EIW87464.1 hypothetical protein CONPUDRAFT_96915 [Coniophora puteana RWD-64-598 SS2] Length = 62 Score = 75.1 bits (183), Expect = 7e-15 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F GLR WPTPV +PM+ FI G+TF+LV K Q+ + SE YAKDPRNP+A + Sbjct: 1 MAFLGLRKWPTPVLRPMAPFIAAAGITFFLVGKMQDMGIRSEEYAKDPRNPYAAQIAKES 60 Query: 262 H 264 H Sbjct: 61 H 61 >KZT44027.1 ATPase, F0 complex, subunit J [Sistotremastrum suecicum HHB10207 ss-3] Length = 62 Score = 74.7 bits (182), Expect = 1e-14 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 MSFFGLR WPTP+ +P+ F I GG+ FY V K Q++ + SE YAKDPRNP+A + Sbjct: 1 MSFFGLRKWPTPIARPLWPFFIAGGIVFYGVQKLQDAGVRSEEYAKDPRNPYASQIAKEA 60 Query: 262 H 264 H Sbjct: 61 H 61 >KIO09949.1 hypothetical protein M404DRAFT_995931 [Pisolithus tinctorius Marx 270] Length = 62 Score = 74.7 bits (182), Expect = 1e-14 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F GLR WPTPV +PM+ FI G+TFYLV Q+ + SETYAKDP+NP+A + Sbjct: 1 MAFLGLRKWPTPVLRPMAPFIAASGITFYLVKTMQDFGVRSETYAKDPKNPYAAQIAREA 60 Query: 262 H 264 H Sbjct: 61 H 61 >KIM54716.1 hypothetical protein SCLCIDRAFT_344482 [Scleroderma citrinum Foug A] Length = 62 Score = 74.7 bits (182), Expect = 1e-14 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+FFGLR WPTPV +PM+ FI G+TFYLV+ Q + SE YAKDP+NP+A + Sbjct: 1 MAFFGLRKWPTPVLRPMAPFIAASGITFYLVSTMQEMGVRSEAYAKDPKNPYAAQIARET 60 Query: 262 H 264 H Sbjct: 61 H 61 >EPS93034.1 hypothetical protein FOMPIDRAFT_1033850 [Fomitopsis pinicola FP-58527 SS1] Length = 62 Score = 74.3 bits (181), Expect = 1e-14 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 MSF GLR WPTPV +PM FI G +TFYLV+KAQ+ + SET+ DPRNP+A + Sbjct: 1 MSFLGLRKWPTPVLRPMWPFIAAGSITFYLVSKAQDLGVRSETWRNDPRNPYAAQIAKEA 60 Query: 262 H 264 H Sbjct: 61 H 61 >XP_007267554.1 hypothetical protein FOMMEDRAFT_51366, partial [Fomitiporia mediterranea MF3/22] EJD02138.1 hypothetical protein FOMMEDRAFT_51366, partial [Fomitiporia mediterranea MF3/22] Length = 59 Score = 72.4 bits (176), Expect = 7e-14 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGK 246 M+F GLR WPTPV KP++ F+ +TFYLV+ QN + SETYA DP+NP+A + Sbjct: 1 MAFLGLRKWPTPVAKPLAPFVAASAITFYLVSSLQNMAVRSETYANDPKNPYAAQ 55 >KZV71955.1 hypothetical protein PENSPDRAFT_378862 [Peniophora sp. CONT] Length = 62 Score = 72.0 bits (175), Expect = 1e-13 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+ FG+R WPTPV KP+ FI G+TFYLV+K Q++ + S YAKDP+NP+A + Sbjct: 1 MALFGMRKWPTPVMKPLWPFIAASGVTFYLVSKVQDAAVRSPEYAKDPKNPYAQQIAKEA 60 Query: 262 H 264 H Sbjct: 61 H 61 >KIM54223.1 hypothetical protein SCLCIDRAFT_1222188 [Scleroderma citrinum Foug A] Length = 62 Score = 72.0 bits (175), Expect = 1e-13 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGK 246 M+FFGLR WPTPV +PM+ FI G+TFYLV+ Q + SE YA DP+NP+A + Sbjct: 1 MAFFGLRKWPTPVLRPMAPFIAASGITFYLVSTMQEMGVRSEAYATDPKNPYAAQ 55 >KIK79424.1 hypothetical protein PAXRUDRAFT_161335 [Paxillus rubicundulus Ve08.2h10] Length = 62 Score = 72.0 bits (175), Expect = 1e-13 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F GLR WPTPV KPM+ FI +TFYLV++ Q+ + SE YAKDP+NP+A + Sbjct: 1 MAFLGLRKWPTPVLKPMAPFIAASAVTFYLVSQMQDMGVRSEAYAKDPKNPYAAQIAKET 60 Query: 262 H 264 H Sbjct: 61 H 61 >KZT00052.1 hypothetical protein LAESUDRAFT_732643 [Laetiporus sulphureus 93-53] Length = 62 Score = 70.5 bits (171), Expect = 4e-13 Identities = 32/61 (52%), Positives = 39/61 (63%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 MSFFG R WPTPV KP+ FI G +T+Y VNK Q+ + SE Y DPRNP+A + Sbjct: 1 MSFFGFRKWPTPVAKPLWPFITAGFVTYYFVNKLQDMAVKSEKYKNDPRNPYAEQIAKEA 60 Query: 262 H 264 H Sbjct: 61 H 61 >XP_013243276.1 putative ATP18-subunit I/j of the mitochondrial F1F0-ATP synthase [Tilletiaria anomala UBC 951] KDN45739.1 putative ATP18-subunit I/j of the mitochondrial F1F0-ATP synthase [Tilletiaria anomala UBC 951] Length = 62 Score = 70.5 bits (171), Expect = 4e-13 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F G +A+PTP+WKP+ FI+ G+ F+ VN QNSM+ S AKDPRNP+ K Sbjct: 1 MAFLGFKAYPTPIWKPLGPFIVASGIVFWGVNALQNSMVKSGENAKDPRNPYGQKVHKES 60 Query: 262 H 264 H Sbjct: 61 H 61 >XP_007863152.1 hypothetical protein GLOTRDRAFT_71680 [Gloeophyllum trabeum ATCC 11539] EPQ57795.1 hypothetical protein GLOTRDRAFT_71680 [Gloeophyllum trabeum ATCC 11539] Length = 62 Score = 70.5 bits (171), Expect = 4e-13 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = +1 Query: 82 MSFFGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAG 261 M+F GLR WPTPV KPM FI GLTFYLV+K Q++ + S +A DP+NP+A + Sbjct: 1 MAFLGLRKWPTPVAKPMWPFIAASGLTFYLVSKMQDAAVKSPEFANDPKNPYAEQIARQS 60 Query: 262 H 264 H Sbjct: 61 H 61 >XP_016269211.1 F-type H+-transporting ATPase subunit j [Rhodotorula toruloides NP11] EMS18092.1 F-type H+-transporting ATPase subunit j [Rhodotorula toruloides NP11] CDR49814.1 RHTO0S34e00496g1_1 [Rhodotorula toruloides] Length = 59 Score = 70.1 bits (170), Expect = 6e-13 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 91 FGLRAWPTPVWKPMSHFIIGGGLTFYLVNKAQNSMLASETYAKDPRNPFAGKKGAAGH 264 FG+RAWPTP +PM F++G G+TFYLVN AQN+ML S+ + P+NP A H Sbjct: 2 FGMRAWPTPFLRPMWPFMVGAGMTFYLVNAAQNAMLQSDEFKNSPKNPHRISSTPAAH 59