BLASTX nr result
ID: Phellodendron21_contig00028700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028700 (552 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415231.1 hypothetical protein MELLADRAFT_117782 [Melampsor... 93 7e-20 KNZ60073.1 hypothetical protein VP01_1614g2 [Puccinia sorghi] 69 2e-10 KNE99759.1 hypothetical protein PSTG_07046 [Puccinia striiformis... 68 5e-10 OAW00046.1 hypothetical protein PTTG_25151 [Puccinia triticina 1... 64 6e-09 >XP_007415231.1 hypothetical protein MELLADRAFT_117782 [Melampsora larici-populina 98AG31] EGG01381.1 hypothetical protein MELLADRAFT_117782 [Melampsora larici-populina 98AG31] Length = 259 Score = 93.2 bits (230), Expect = 7e-20 Identities = 42/60 (70%), Positives = 54/60 (90%), Gaps = 1/60 (1%) Frame = -3 Query: 508 EEAWPA-VRVRFCEGAAQEVLTWSAETYDRKGPEPISRLSMREVIELRLIKQEVLELGPQ 332 E++W VRVRFCEGA +E+LTWSAETYDRKGPEP+++LSMRE+IEL+LIK+EVL+ G + Sbjct: 198 EDSWTTPVRVRFCEGAVEEILTWSAETYDRKGPEPVNKLSMREMIELKLIKEEVLKTGQE 257 >KNZ60073.1 hypothetical protein VP01_1614g2 [Puccinia sorghi] Length = 296 Score = 68.6 bits (166), Expect = 2e-10 Identities = 31/48 (64%), Positives = 41/48 (85%) Frame = -3 Query: 493 AVRVRFCEGAAQEVLTWSAETYDRKGPEPISRLSMREVIELRLIKQEV 350 AVRVRF + +E LTWS E+YDRKGP PI++L++REVIEL+LIK+E+ Sbjct: 200 AVRVRFDDDTVEEFLTWSRESYDRKGPMPITKLNLREVIELKLIKEEL 247 >KNE99759.1 hypothetical protein PSTG_07046 [Puccinia striiformis f. sp. tritici PST-78] Length = 410 Score = 67.8 bits (164), Expect = 5e-10 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = -3 Query: 490 VRVRFCEGAAQEVLTWSAETYDRKGPEPISRLSMREVIELRLIKQEV 350 VRVRF + +E+LTWS E+YDRKGP PI +L++REVIEL+LIK+E+ Sbjct: 259 VRVRFADDTVEELLTWSRESYDRKGPLPIMKLNLREVIELKLIKEEL 305 >OAW00046.1 hypothetical protein PTTG_25151 [Puccinia triticina 1-1 BBBD Race 1] Length = 315 Score = 64.3 bits (155), Expect = 6e-09 Identities = 27/48 (56%), Positives = 41/48 (85%) Frame = -3 Query: 493 AVRVRFCEGAAQEVLTWSAETYDRKGPEPISRLSMREVIELRLIKQEV 350 + RVRF + +++LTWS E+YDRKGP PI++L++RE+IEL+LIK+E+ Sbjct: 199 SARVRFDDATVEQLLTWSRESYDRKGPLPITKLNLRELIELKLIKEEL 246