BLASTX nr result
ID: Phellodendron21_contig00028580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028580 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414073.1 hypothetical protein MELLADRAFT_72750 [Melampsora... 53 5e-07 KNE90802.1 hypothetical protein PSTG_15768 [Puccinia striiformis... 54 4e-06 >XP_007414073.1 hypothetical protein MELLADRAFT_72750 [Melampsora larici-populina 98AG31] EGG02671.1 hypothetical protein MELLADRAFT_72750 [Melampsora larici-populina 98AG31] Length = 66 Score = 52.8 bits (125), Expect = 5e-07 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 295 EVVQKPKDDDPIGEKLVKTERPLEVAADLLKPIEAGLCSGR 173 E V KD+ PIG+KLVKTE PLE AA+LLKPIE LC R Sbjct: 24 EAVPPIKDEYPIGDKLVKTETPLEKAAELLKPIEVKLCVKR 64 >KNE90802.1 hypothetical protein PSTG_15768 [Puccinia striiformis f. sp. tritici PST-78] Length = 1004 Score = 53.9 bits (128), Expect = 4e-06 Identities = 33/65 (50%), Positives = 39/65 (60%), Gaps = 7/65 (10%) Frame = -2 Query: 295 EVVQKPKDDDPIGEKLVKTERPLEVAADLLKPIEAGLCSGRRKTGV---KMEVW----LL 137 EV+ DDDP GEKL+K E PLE+A +LLKPIE L K+ V K +W L Sbjct: 713 EVIPPIVDDDPTGEKLLKNENPLEMANELLKPIEDDLARFSAKSIVDPTKRSIWHGVYLC 772 Query: 136 RFEIE 122 RFEIE Sbjct: 773 RFEIE 777