BLASTX nr result
ID: Phellodendron21_contig00028556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028556 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415432.1 hypothetical protein MELLADRAFT_67181 [Melampsora... 124 2e-30 >XP_007415432.1 hypothetical protein MELLADRAFT_67181 [Melampsora larici-populina 98AG31] EGG01331.1 hypothetical protein MELLADRAFT_67181 [Melampsora larici-populina 98AG31] Length = 927 Score = 124 bits (310), Expect = 2e-30 Identities = 59/104 (56%), Positives = 74/104 (71%), Gaps = 5/104 (4%) Frame = +3 Query: 78 WPLIAKLERADPAAVAFYLGCILGPWFFIIGGWYLSPRKGELGRTVTQP--RLPVRIQNL 251 W + LERADPAAV F+LGC+ GPWFF+IGGWYLSPR GE+G++ R P R++NL Sbjct: 816 WLFMEMLERADPAAVTFWLGCLFGPWFFVIGGWYLSPRIGEIGQSKFNQHLRFPNRVKNL 875 Query: 252 SNGN---LKLNSTTPTGISWVLANRVATCVTGPIAMGLMIWSLV 374 SNG + + + G+SWV ANRVA CVTGP+ +G IWSLV Sbjct: 876 SNGRTTPISQHHSHHNGLSWVNANRVAACVTGPLVLGGFIWSLV 919