BLASTX nr result
ID: Phellodendron21_contig00028490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028490 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007409224.1 hypothetical protein MELLADRAFT_85717 [Melampsora... 108 2e-27 XP_003307455.2 hypothetical protein PGTG_00405 [Puccinia gramini... 96 9e-22 OAV88960.1 hypothetical protein PTTG_12210 [Puccinia triticina 1... 93 1e-20 KNZ54916.1 hypothetical protein VP01_2818g7 [Puccinia sorghi] 92 1e-19 KNE99365.1 hypothetical protein PSTG_07297 [Puccinia striiformis... 90 3e-19 XP_003327548.1 hypothetical protein PGTG_09082 [Puccinia gramini... 89 3e-19 OAV86763.1 hypothetical protein PTTG_05567 [Puccinia triticina 1... 86 5e-18 XP_014568050.1 hypothetical protein L969DRAFT_49637 [Mixia osmun... 70 5e-12 KIY50179.1 hypothetical protein FISHEDRAFT_7236, partial [Fistul... 65 1e-10 KDE06729.1 hypothetical protein MVLG_02925 [Microbotryum lychnid... 66 2e-10 XP_003030361.1 hypothetical protein SCHCODRAFT_57143 [Schizophyl... 65 4e-10 KZV81101.1 hypothetical protein EXIGLDRAFT_592138, partial [Exid... 62 8e-10 CBQ73321.1 conserved hypothetical protein [Sporisorium reilianum... 64 9e-10 KZT63765.1 hypothetical protein DAEQUDRAFT_733472 [Daedalea quer... 64 9e-10 EPS99872.1 hypothetical protein FOMPIDRAFT_1030712 [Fomitopsis p... 64 1e-09 KIJ18839.1 hypothetical protein PAXINDRAFT_166803 [Paxillus invo... 63 2e-09 CEQ41947.1 SPOSA6832_03703 [Sporidiobolus salmonicolor] 63 2e-09 KZT11089.1 hypothetical protein LAESUDRAFT_672827 [Laetiporus su... 62 3e-09 KDQ21687.1 hypothetical protein BOTBODRAFT_26116 [Botryobasidium... 63 3e-09 KIK97218.1 hypothetical protein PAXRUDRAFT_825158 [Paxillus rubi... 62 4e-09 >XP_007409224.1 hypothetical protein MELLADRAFT_85717 [Melampsora larici-populina 98AG31] EGG07317.1 hypothetical protein MELLADRAFT_85717 [Melampsora larici-populina 98AG31] Length = 201 Score = 108 bits (271), Expect = 2e-27 Identities = 53/71 (74%), Positives = 60/71 (84%) Frame = -2 Query: 367 NRTNNSDDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRK 188 + +N++DD T GS S + Q+LLWTTAIVAYT HKT LLPVRVGLTAWLTPPI+R LRK Sbjct: 134 SNSNDADDQTPGS---SGQVQSLLWTTAIVAYTFHKTVLLPVRVGLTAWLTPPIIRTLRK 190 Query: 187 RGWNVGKNLKS 155 RGWNVGKNLKS Sbjct: 191 RGWNVGKNLKS 201 >XP_003307455.2 hypothetical protein PGTG_00405 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP74449.2 hypothetical protein PGTG_00405 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 275 Score = 96.3 bits (238), Expect = 9e-22 Identities = 42/67 (62%), Positives = 52/67 (77%) Frame = -2 Query: 361 TNNSDDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRG 182 T ++ T G + ++ N+LWTTA+VAYTIHKT LLP R+GLTAW+TPPIVR LRKRG Sbjct: 208 TATTNTTTDGEEATKRDDNNMLWTTAVVAYTIHKTILLPFRIGLTAWITPPIVRHLRKRG 267 Query: 181 WNVGKNL 161 W VG+NL Sbjct: 268 WKVGRNL 274 >OAV88960.1 hypothetical protein PTTG_12210 [Puccinia triticina 1-1 BBBD Race 1] Length = 273 Score = 93.2 bits (230), Expect = 1e-20 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -2 Query: 340 TVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNL 161 T P ++ N+LWTTA+VAYTIHKT LLP R+GLTAW+TPPIVR LRKRGW VG+NL Sbjct: 213 TTPVPQGAETENNMLWTTAVVAYTIHKTILLPFRIGLTAWMTPPIVRLLRKRGWKVGRNL 272 >KNZ54916.1 hypothetical protein VP01_2818g7 [Puccinia sorghi] Length = 331 Score = 91.7 bits (226), Expect = 1e-19 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 322 SSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNLK 158 +S+ N+ WTTA+VAYTIHKT LLPVR+GLTAW+TPP+VR LRKRGW VG+NL+ Sbjct: 277 ASEHDANMFWTTAVVAYTIHKTILLPVRLGLTAWITPPLVRYLRKRGWKVGRNLE 331 >KNE99365.1 hypothetical protein PSTG_07297 [Puccinia striiformis f. sp. tritici PST-78] KNE99366.1 hypothetical protein, variant [Puccinia striiformis f. sp. tritici PST-78] Length = 291 Score = 90.1 bits (222), Expect = 3e-19 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -2 Query: 352 SDDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNV 173 S+ T + +++ ++LWTTA+VAYTIHKT LLP R+GLTAW+TPPIVR LRKRGW V Sbjct: 227 SNTTTTTTTGTTEIDSSMLWTTAVVAYTIHKTILLPFRIGLTAWITPPIVRQLRKRGWKV 286 Query: 172 GKNL 161 G+NL Sbjct: 287 GRNL 290 >XP_003327548.1 hypothetical protein PGTG_09082 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP83129.1 hypothetical protein PGTG_09082 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 230 Score = 88.6 bits (218), Expect = 3e-19 Identities = 39/61 (63%), Positives = 49/61 (80%) Frame = -2 Query: 340 TVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNL 161 T P S+ ++LWT+A+VAYTIHKT LLPVR+ LTAW+TPPIVR LRKRGW +G+NL Sbjct: 170 TTSVPGGSEIDSDMLWTSAVVAYTIHKTILLPVRILLTAWITPPIVRHLRKRGWKIGRNL 229 Query: 160 K 158 + Sbjct: 230 E 230 >OAV86763.1 hypothetical protein PTTG_05567 [Puccinia triticina 1-1 BBBD Race 1] Length = 229 Score = 85.5 bits (210), Expect = 5e-18 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -2 Query: 304 NLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNLK 158 N+LWTT +VAYTIHKT LLP R+ LTAW+TPPIVR LRKRGW VG+NL+ Sbjct: 181 NMLWTTTLVAYTIHKTILLPFRILLTAWITPPIVRHLRKRGWKVGRNLE 229 >XP_014568050.1 hypothetical protein L969DRAFT_49637 [Mixia osmundae IAM 14324] GAA96430.1 hypothetical protein E5Q_03097 [Mixia osmundae IAM 14324] KEI39463.1 hypothetical protein L969DRAFT_49637 [Mixia osmundae IAM 14324] Length = 275 Score = 70.5 bits (171), Expect = 5e-12 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 292 TTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 TTA++AY IHKT LLP R+GLTAW+TPP+ R+LR+ GWN+G Sbjct: 218 TTAVLAYAIHKTLLLPFRIGLTAWITPPLFRSLRRWGWNIG 258 >KIY50179.1 hypothetical protein FISHEDRAFT_7236, partial [Fistulina hepatica ATCC 64428] Length = 173 Score = 65.1 bits (157), Expect = 1e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -2 Query: 310 GQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGW 179 G L+ T ++AYTIHKT LPVRVGLTA LTPP+VR LR RGW Sbjct: 120 GHGSLYATIVLAYTIHKTLFLPVRVGLTAALTPPLVRWLRMRGW 163 >KDE06729.1 hypothetical protein MVLG_02925 [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 325 Score = 66.2 bits (160), Expect = 2e-10 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -2 Query: 337 VGSPVSSK--EGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 VG+ S K +G + + TTA++AY IHKT LLPVRVGLT +TP VR L+ GWNVG Sbjct: 243 VGTDASGKHQDGYSAIATTAVLAYAIHKTLLLPVRVGLTVAITPKFVRTLQSWGWNVG 300 >XP_003030361.1 hypothetical protein SCHCODRAFT_57143 [Schizophyllum commune H4-8] EFI95458.1 hypothetical protein SCHCODRAFT_57143 [Schizophyllum commune H4-8] Length = 225 Score = 64.7 bits (156), Expect = 4e-10 Identities = 31/53 (58%), Positives = 37/53 (69%) Frame = -2 Query: 328 PVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 PV S++G L+ ++AYTIHKT LPVRVGLTA LTP +V LR RGW G Sbjct: 142 PVQSRKGNEGLYAMIVLAYTIHKTLFLPVRVGLTAGLTPKLVNWLRARGWAGG 194 >KZV81101.1 hypothetical protein EXIGLDRAFT_592138, partial [Exidia glandulosa HHB12029] Length = 132 Score = 62.0 bits (149), Expect = 8e-10 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 298 LWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGW 179 LW ++AYT+HKT LPVR+GLTA +TPP+VR LR RGW Sbjct: 93 LWAMLLLAYTLHKTVFLPVRIGLTATVTPPLVRWLRTRGW 132 >CBQ73321.1 conserved hypothetical protein [Sporisorium reilianum SRZ2] Length = 279 Score = 64.3 bits (155), Expect = 9e-10 Identities = 32/58 (55%), Positives = 37/58 (63%) Frame = -2 Query: 352 SDDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGW 179 SDD S K G +WT A++AYTIHKT LLPVRV LTA +TP V+ L K GW Sbjct: 186 SDDDDSTSSSKGKGGSGTIWTEAVLAYTIHKTLLLPVRVALTAAVTPSFVKWLVKMGW 243 >KZT63765.1 hypothetical protein DAEQUDRAFT_733472 [Daedalea quercina L-15889] Length = 221 Score = 63.5 bits (153), Expect = 9e-10 Identities = 32/64 (50%), Positives = 40/64 (62%) Frame = -2 Query: 349 DDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 D+M S + GQ L+ ++AYT+HKT LPVRVGLTA LTP +V LR RGW G Sbjct: 143 DEMDSVSSHTHNGGQESLYAMIVLAYTVHKTLFLPVRVGLTATLTPRLVHWLRARGWAGG 202 Query: 169 KNLK 158 + K Sbjct: 203 EGAK 206 >EPS99872.1 hypothetical protein FOMPIDRAFT_1030712 [Fomitopsis pinicola FP-58527 SS1] Length = 223 Score = 63.5 bits (153), Expect = 1e-09 Identities = 31/64 (48%), Positives = 39/64 (60%) Frame = -2 Query: 349 DDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 ++M S + GQ W ++AYT+HKT LPVRVGLTA LTP +V LR RGW G Sbjct: 145 EEMESMSSHARSGGQEGFWAMLLLAYTVHKTLFLPVRVGLTATLTPKVVHWLRARGWAGG 204 Query: 169 KNLK 158 + K Sbjct: 205 EGTK 208 >KIJ18839.1 hypothetical protein PAXINDRAFT_166803 [Paxillus involutus ATCC 200175] Length = 222 Score = 62.8 bits (151), Expect = 2e-09 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = -2 Query: 337 VGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNLK 158 + S +++ GQ L+ ++AYTIHKT LPVRVGLTA LTP IV LR RGW G+ K Sbjct: 146 IESTTANQGGQEGLYAMLVLAYTIHKTLFLPVRVGLTAALTPRIVGWLRMRGWAGGEGTK 205 >CEQ41947.1 SPOSA6832_03703 [Sporidiobolus salmonicolor] Length = 289 Score = 63.2 bits (152), Expect = 2e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 319 SKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 +++G + TTA++AY IHKT LLPVRVG+T +TP +VR LR GWNVG Sbjct: 220 AEKGYSAYATTAVLAYAIHKTALLPVRVGITVAITPKVVRMLRGWGWNVG 269 >KZT11089.1 hypothetical protein LAESUDRAFT_672827 [Laetiporus sulphureus 93-53] Length = 225 Score = 62.4 bits (150), Expect = 3e-09 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = -2 Query: 349 DDMTVGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVG 170 ++M S +S GQ L+ ++AYT+HKT LPVRVGLTA LTP +VR L+ RGW G Sbjct: 145 EEMESMSSHASAGGQESLYAMLVLAYTVHKTLFLPVRVGLTAALTPRLVRWLQVRGWAGG 204 Query: 169 KNLK 158 K Sbjct: 205 AGTK 208 >KDQ21687.1 hypothetical protein BOTBODRAFT_26116 [Botryobasidium botryosum FD-172 SS1] Length = 258 Score = 62.8 bits (151), Expect = 3e-09 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = -2 Query: 334 GSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGW 179 GS S+ G LW +++Y IHKT LLPVRVGLTA TP +VR L RGW Sbjct: 181 GSDAPSQNGSESLWAMIVLSYAIHKTLLLPVRVGLTAAFTPRLVRWLTSRGW 232 >KIK97218.1 hypothetical protein PAXRUDRAFT_825158 [Paxillus rubicundulus Ve08.2h10] Length = 220 Score = 62.0 bits (149), Expect = 4e-09 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = -2 Query: 337 VGSPVSSKEGQNLLWTTAIVAYTIHKTFLLPVRVGLTAWLTPPIVRALRKRGWNVGKNLK 158 + S + + GQ L+ ++AYTIHKT LPVRVGLTA LTP +V LR RGW G+ K Sbjct: 144 IDSTTADQGGQEGLYAMLVLAYTIHKTLFLPVRVGLTAALTPKMVGWLRMRGWAGGEGTK 203