BLASTX nr result
ID: Phellodendron21_contig00028286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028286 (617 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42042.1 hypothetical protein CISIN_1g039178mg [Citrus sinensis] 59 1e-06 XP_006447162.1 hypothetical protein CICLE_v10015170mg [Citrus cl... 58 2e-06 >KDO42042.1 hypothetical protein CISIN_1g039178mg [Citrus sinensis] Length = 445 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 5/52 (9%) Frame = +1 Query: 475 IINCSNSMSLSGLDKESE--NRDSKRMEKIELKKSYFE---ACSEVADDDNN 615 ++NC +S S S LDKESE NRD +RME ELK SYFE +C ADDDNN Sbjct: 1 MMNCGDSKSFSSLDKESESGNRDCERMENTELKNSYFEEACSCKVAADDDNN 52 >XP_006447162.1 hypothetical protein CICLE_v10015170mg [Citrus clementina] XP_006469976.1 PREDICTED: F-box protein SKIP14 [Citrus sinensis] ESR60402.1 hypothetical protein CICLE_v10015170mg [Citrus clementina] Length = 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 4/51 (7%) Frame = +1 Query: 475 IINCSNSMSLSGLDKESE--NRDSKRMEKIELKKSYF-EACS-EVADDDNN 615 ++NC +S S S LDKESE NRD +RME ELK SYF EACS +VADDD+N Sbjct: 1 MMNCGDSKSFSSLDKESESGNRDCERMENTELKNSYFEEACSCKVADDDDN 51