BLASTX nr result
ID: Phellodendron21_contig00028220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028220 (734 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006429438.1 hypothetical protein CICLE_v10011094mg [Citrus cl... 101 8e-21 KDO56715.1 hypothetical protein CISIN_1g003315mg [Citrus sinensis] 101 8e-21 XP_006481070.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 8e-21 OAY57316.1 hypothetical protein MANES_02G087700 [Manihot esculen... 92 9e-18 CDO99945.1 unnamed protein product [Coffea canephora] 89 2e-16 XP_007212814.1 hypothetical protein PRUPE_ppa003248mg [Prunus pe... 86 2e-15 ONI11769.1 hypothetical protein PRUPE_4G124300 [Prunus persica] 86 2e-15 XP_012082864.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 7e-15 XP_004293847.2 PREDICTED: pentatricopeptide repeat-containing pr... 84 7e-15 XP_008225971.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 1e-14 XP_015578905.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 2e-14 KDP28234.1 hypothetical protein JCGZ_14005 [Jatropha curcas] 82 2e-14 EEF36485.1 pentatricopeptide repeat-containing protein, putative... 82 2e-14 XP_011099772.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-14 XP_011099771.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-14 XP_009795704.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 3e-14 XP_018830440.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 4e-14 XP_016548151.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 1e-13 OMO55847.1 hypothetical protein CCACVL1_26963 [Corchorus capsula... 80 2e-13 OMO83596.1 hypothetical protein COLO4_22429 [Corchorus olitorius] 80 2e-13 >XP_006429438.1 hypothetical protein CICLE_v10011094mg [Citrus clementina] ESR42678.1 hypothetical protein CICLE_v10011094mg [Citrus clementina] Length = 810 Score = 101 bits (251), Expect = 8e-21 Identities = 51/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI++LC + NLE I VF E+ DRGLEPDT+TYT LL G+ KGD+D +++L D+MS Sbjct: 723 YTVLIAKLCNTQNLEDGITVFNEISDRGLEPDTVTYTALLCGYLAKGDLDRAIALVDEMS 782 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 ++GIQ D+YT SS+ERG KAR LQ H Sbjct: 783 VKGIQGDDYTKSSLERGIEKARILQYRH 810 >KDO56715.1 hypothetical protein CISIN_1g003315mg [Citrus sinensis] Length = 831 Score = 101 bits (251), Expect = 8e-21 Identities = 51/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI++LC + NLE I VF E+ DRGLEPDT+TYT LL G+ KGD+D +++L D+MS Sbjct: 744 YTVLIAKLCNTQNLEDGITVFNEISDRGLEPDTVTYTALLCGYLAKGDLDRAIALVDEMS 803 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 ++GIQ D+YT SS+ERG KAR LQ H Sbjct: 804 VKGIQGDDYTKSSLERGIEKARILQYRH 831 >XP_006481070.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] XP_006481071.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] XP_006481072.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] XP_006481073.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] XP_006481074.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] XP_015386788.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Citrus sinensis] Length = 831 Score = 101 bits (251), Expect = 8e-21 Identities = 51/88 (57%), Positives = 68/88 (77%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI++LC + NLE I VF E+ DRGLEPDT+TYT LL G+ KGD+D +++L D+MS Sbjct: 744 YTVLIAKLCNTQNLEDGITVFNEISDRGLEPDTVTYTALLCGYLAKGDLDRAIALVDEMS 803 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 ++GIQ D+YT SS+ERG KAR LQ H Sbjct: 804 VKGIQGDDYTKSSLERGIEKARILQYRH 831 >OAY57316.1 hypothetical protein MANES_02G087700 [Manihot esculenta] OAY57317.1 hypothetical protein MANES_02G087700 [Manihot esculenta] Length = 851 Score = 92.4 bits (228), Expect = 9e-18 Identities = 47/85 (55%), Positives = 66/85 (77%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLS-LDKMS 535 +T+LI CK++NL+ A+ +F EMI+RGLEPDT+TYT LL G +GDVD +++ LD+MS Sbjct: 764 YTVLIDGHCKADNLQDAVCLFDEMIERGLEPDTVTYTALLSGLCNRGDVDKAVNLLDQMS 823 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 L+GI D TMS++ERG KAR++Q Sbjct: 824 LKGILPDTRTMSALERGILKARKVQ 848 >CDO99945.1 unnamed protein product [Coffea canephora] Length = 827 Score = 88.6 bits (218), Expect = 2e-16 Identities = 46/89 (51%), Positives = 67/89 (75%), Gaps = 1/89 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T LI CKSNNL+ AI +F EMID GLEPDT+TY+ LL G+ + DVD ++SL ++MS Sbjct: 726 YTALIDSHCKSNNLQDAIDLFNEMIDIGLEPDTVTYSALLCGYCKRRDVDRAVSLVNEMS 785 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWHR 448 L+GI+ D++TMS++ G KA+++Q H+ Sbjct: 786 LKGIEPDSHTMSTLYHGILKAKKVQFQHK 814 >XP_007212814.1 hypothetical protein PRUPE_ppa003248mg [Prunus persica] Length = 589 Score = 85.5 bits (210), Expect = 2e-15 Identities = 42/85 (49%), Positives = 65/85 (76%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI R CK++NL+ AI +F EM +RGLEPDT+TYT LL G +GDVD +++L ++MS Sbjct: 502 YTVLIDRQCKTDNLQDAIALFDEMTNRGLEPDTVTYTALLSGCCNRGDVDKAVTLVNEMS 561 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 +GIQ D++T+ ++ G KA+++Q Sbjct: 562 SKGIQPDSHTLLVLQHGILKAKKVQ 586 >ONI11769.1 hypothetical protein PRUPE_4G124300 [Prunus persica] Length = 838 Score = 85.5 bits (210), Expect = 2e-15 Identities = 42/85 (49%), Positives = 65/85 (76%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI R CK++NL+ AI +F EM +RGLEPDT+TYT LL G +GDVD +++L ++MS Sbjct: 751 YTVLIDRQCKTDNLQDAIALFDEMTNRGLEPDTVTYTALLSGCCNRGDVDKAVTLVNEMS 810 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 +GIQ D++T+ ++ G KA+++Q Sbjct: 811 SKGIQPDSHTLLVLQHGILKAKKVQ 835 >XP_012082864.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Jatropha curcas] XP_012082865.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Jatropha curcas] XP_012082866.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Jatropha curcas] Length = 826 Score = 84.0 bits (206), Expect = 7e-15 Identities = 46/85 (54%), Positives = 62/85 (72%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLS-LDKMS 535 +T+LI CK+NNLE AI +F +MID GL+PDT+TYT LL G +GDVD + + L++MS Sbjct: 736 YTVLIDGRCKANNLEDAICLFDQMIDEGLQPDTVTYTALLSGCFSRGDVDRADNLLNQMS 795 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 +GI D TMS +ERG KAR++Q Sbjct: 796 EKGIFPDACTMSILERGILKARKVQ 820 >XP_004293847.2 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Fragaria vesca subsp. vesca] XP_011460560.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Fragaria vesca subsp. vesca] Length = 842 Score = 84.0 bits (206), Expect = 7e-15 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+L+ R CK++NL AI +F MI+RGL+PDT+TYT LL G +GDVD +++L ++MS Sbjct: 755 YTVLVDRHCKADNLRDAIALFDVMIERGLKPDTVTYTALLSGCCKRGDVDRAVTLVNEMS 814 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 GIQ D YT+S ++ G KA+++Q Sbjct: 815 SRGIQPDAYTLSVLQHGILKAKKVQ 839 >XP_008225971.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] XP_008225972.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] XP_008225973.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] XP_016648402.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Prunus mume] Length = 838 Score = 83.6 bits (205), Expect = 1e-14 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI R CK++NL+ AI +F EM +RGLEPDT+TYT LL G +GDVD +++L ++MS Sbjct: 751 YTVLIDRQCKTDNLQDAIALFDEMTNRGLEPDTVTYTALLSGCCNRGDVDKAVTLVNEMS 810 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 +GIQ D T+ ++ G KA+++Q Sbjct: 811 SKGIQPDTRTLLVLQHGILKAKKVQ 835 >XP_015578905.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Ricinus communis] Length = 830 Score = 82.8 bits (203), Expect = 2e-14 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 1/84 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLS-LDKMS 535 +T+LI CK ++L AIGVF EMI+RGLEPD +TYT LL G +GDVD +++ LD+MS Sbjct: 739 YTVLIDGYCKVDSLHDAIGVFDEMIERGLEPDIITYTALLSGCCQRGDVDRAVNLLDQMS 798 Query: 534 LEGIQADNYTMSSVERGAGKARRL 463 L+GI D TMS++ G K R++ Sbjct: 799 LKGISPDTRTMSALLHGILKTRQV 822 >KDP28234.1 hypothetical protein JCGZ_14005 [Jatropha curcas] Length = 869 Score = 82.4 bits (202), Expect = 2e-14 Identities = 46/86 (53%), Positives = 61/86 (70%), Gaps = 1/86 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLS-LDKMS 535 +T+LI CK+NNLE AI +F +MID GL+PDT+TYT LL G +GDVD + + L++MS Sbjct: 737 YTVLIDGRCKANNLEDAICLFDQMIDEGLQPDTVTYTALLSGCFSRGDVDRADNLLNQMS 796 Query: 534 LEGIQADNYTMSSVERGAGKARRLQC 457 +GI D TMS +ERG KAR+ C Sbjct: 797 EKGIFPDACTMSILERGILKARKGCC 822 >EEF36485.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 913 Score = 82.4 bits (202), Expect = 2e-14 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLS-LDKMS 535 +T+LI CK ++L AIGVF EMI+RGLEPD +TYT LL G +GDVD +++ LD+MS Sbjct: 739 YTVLIDGYCKVDSLHDAIGVFDEMIERGLEPDIITYTALLSGCCQRGDVDRAVNLLDQMS 798 Query: 534 LEGIQADNYTMSSVERGAGKARR 466 L+GI D TMS++ G K R+ Sbjct: 799 LKGISPDTRTMSALLHGILKTRQ 821 >XP_011099772.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial isoform X2 [Sesamum indicum] Length = 743 Score = 82.0 bits (201), Expect = 3e-14 Identities = 43/88 (48%), Positives = 64/88 (72%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T LI CKS+NLE AI +F EMI +GL PDT+TYT LL G+ +GD++ +L+L ++MS Sbjct: 656 YTALIDSQCKSDNLEDAICLFNEMIQQGLLPDTVTYTALLSGYCKQGDMEKALTLVNEMS 715 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 +GIQ D+ TMS++ G +A+++Q H Sbjct: 716 SKGIQPDSRTMSTLHHGIVRAKKVQFRH 743 >XP_011099771.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial isoform X1 [Sesamum indicum] Length = 823 Score = 82.0 bits (201), Expect = 3e-14 Identities = 43/88 (48%), Positives = 64/88 (72%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T LI CKS+NLE AI +F EMI +GL PDT+TYT LL G+ +GD++ +L+L ++MS Sbjct: 736 YTALIDSQCKSDNLEDAICLFNEMIQQGLLPDTVTYTALLSGYCKQGDMEKALTLVNEMS 795 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 +GIQ D+ TMS++ G +A+++Q H Sbjct: 796 SKGIQPDSRTMSTLHHGIVRAKKVQFRH 823 >XP_009795704.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_009795705.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_009795706.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_009795707.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_009795708.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_009795709.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Nicotiana sylvestris] XP_016456394.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456395.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456396.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456398.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456399.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456400.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] XP_016456401.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Nicotiana tabacum] Length = 837 Score = 82.0 bits (201), Expect = 3e-14 Identities = 40/88 (45%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI R CKS+N++ AI +F EMIDRGLEPD++TYT L+ G+ +G V+++ L ++M Sbjct: 737 YTVLIDRHCKSDNIDDAIRLFTEMIDRGLEPDSVTYTALICGYCKQGQVEMAKDLVNEMW 796 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWH 451 +GIQ D++T+S++ G KA+++ H Sbjct: 797 SKGIQPDSHTISALHHGIIKAKKVHLRH 824 >XP_018830440.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Juglans regia] XP_018830441.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Juglans regia] XP_018830442.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Juglans regia] XP_018830444.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Juglans regia] XP_018830445.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Juglans regia] Length = 831 Score = 81.6 bits (200), Expect = 4e-14 Identities = 42/85 (49%), Positives = 62/85 (72%), Gaps = 1/85 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI CK+++L+ A+ +F EMIDRGLEPDT+TYT LL G GDVD +++L ++MS Sbjct: 744 YTVLIDGHCKTDSLQDAVALFDEMIDRGLEPDTVTYTALLSGSCNMGDVDRAVTLFNEMS 803 Query: 534 LEGIQADNYTMSSVERGAGKARRLQ 460 +GI D T+S + RG KA+++Q Sbjct: 804 SKGILPDTQTISVLHRGIIKAKKVQ 828 >XP_016548151.1 PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Capsicum annuum] Length = 836 Score = 80.1 bits (196), Expect = 1e-13 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 1/99 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI CKS+N++ AI +F EMID+GLEPD++TYT L+ G+ +G V+ + L +KM Sbjct: 738 YTVLIDSRCKSDNIDDAIRLFTEMIDKGLEPDSVTYTALICGYCKQGHVEKAKDLVNKMW 797 Query: 534 LEGIQADNYTMSSVERGAGKARRLQCWHRAVCSV*VGRW 418 +GIQ D++T+S++ G KA++L H + RW Sbjct: 798 RKGIQPDSHTISALHHGIIKAKKLHLRHHNNSAKNQRRW 836 >OMO55847.1 hypothetical protein CCACVL1_26963 [Corchorus capsularis] Length = 1222 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/84 (46%), Positives = 61/84 (72%), Gaps = 1/84 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI + CK+NNL+ AI +F EMID GL+PD +TYT L+ G+ +G V+ +++L ++MS Sbjct: 1136 YTVLIDQYCKTNNLQDAIRIFDEMIDSGLQPDNMTYTALISGYCKRGYVEKAVTLVNEMS 1195 Query: 534 LEGIQADNYTMSSVERGAGKARRL 463 GI+ D TM ++ RG KA+R+ Sbjct: 1196 SRGIEPDTCTMLTLHRGVLKAKRV 1219 >OMO83596.1 hypothetical protein COLO4_22429 [Corchorus olitorius] Length = 787 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/84 (46%), Positives = 61/84 (72%), Gaps = 1/84 (1%) Frame = -3 Query: 711 FTILISRLCKSNNLEAAIGVFYEMIDRGLEPDTLTYTTLLRGFKGKGDVDLSLSL-DKMS 535 +T+LI + CK+NNL+ AI +F EMID GL+PD +TYT L+ G+ +G V+ +++L ++MS Sbjct: 620 YTVLIDQYCKTNNLQDAIRIFDEMIDSGLQPDNMTYTALISGYCKRGCVEKAVTLVNEMS 679 Query: 534 LEGIQADNYTMSSVERGAGKARRL 463 GI+ D TM ++ RG KA+R+ Sbjct: 680 SRGIEPDTCTMLTLNRGILKAKRV 703