BLASTX nr result
ID: Phellodendron21_contig00028188
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028188 (274 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006443074.1 hypothetical protein CICLE_v10022453mg [Citrus cl... 72 1e-13 KDO43501.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] 72 2e-13 >XP_006443074.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006443075.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006443076.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006443077.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006443078.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006443079.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] XP_006494181.1 PREDICTED: uncharacterized protein LOC102619684 [Citrus sinensis] ESR56314.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] ESR56315.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] ESR56316.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] ESR56317.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] ESR56318.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] ESR56319.1 hypothetical protein CICLE_v10022453mg [Citrus clementina] KDO43493.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43494.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43495.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43496.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43497.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43498.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43499.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] KDO43500.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] Length = 185 Score = 71.6 bits (174), Expect = 1e-13 Identities = 43/77 (55%), Positives = 45/77 (58%), Gaps = 2/77 (2%) Frame = -3 Query: 227 MGSFSCETESWVSSKATI--QETHDLKQEPQFLTITRTGFXXXXXXXXXXXXXXXXXXXX 54 MG FSCETESWV S I +ETHDL QEPQFLTITR+GF Sbjct: 1 MGRFSCETESWVDSSEAIMEEETHDLNQEPQFLTITRSGF------DEEESEELLKNENK 54 Query: 53 XXXXNQVLLEGYVETDS 3 NQVLLEGYVETDS Sbjct: 55 KKKKNQVLLEGYVETDS 71 >KDO43501.1 hypothetical protein CISIN_1g029447mg [Citrus sinensis] Length = 193 Score = 71.6 bits (174), Expect = 2e-13 Identities = 43/77 (55%), Positives = 45/77 (58%), Gaps = 2/77 (2%) Frame = -3 Query: 227 MGSFSCETESWVSSKATI--QETHDLKQEPQFLTITRTGFXXXXXXXXXXXXXXXXXXXX 54 MG FSCETESWV S I +ETHDL QEPQFLTITR+GF Sbjct: 1 MGRFSCETESWVDSSEAIMEEETHDLNQEPQFLTITRSGF------DEEESEELLKNENK 54 Query: 53 XXXXNQVLLEGYVETDS 3 NQVLLEGYVETDS Sbjct: 55 KKKKNQVLLEGYVETDS 71