BLASTX nr result
ID: Phellodendron21_contig00028056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00028056 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016763620.1 UV excision repair protein Rad23 [Sphaerulina mus... 109 1e-26 XP_007676024.1 hypothetical protein BAUCODRAFT_33528 [Baudoinia ... 104 9e-25 EME48123.1 hypothetical protein DOTSEDRAFT_69906 [Dothistroma se... 103 3e-24 XP_013347610.1 hypothetical protein AUEXF2481DRAFT_76980 [Aureob... 102 4e-24 KEQ79540.1 UV excision repair protein Rad23 [Aureobasidium pullu... 102 4e-24 XP_007922943.1 hypothetical protein MYCFIDRAFT_119289, partial [... 102 7e-24 KEQ65140.1 UV excision repair protein Rad23 [Aureobasidium melan... 101 1e-23 XP_013431255.1 UV excision repair protein Rad23 [Aureobasidium n... 101 1e-23 KXT17389.1 hypothetical protein AC579_3856 [Pseudocercospora musae] 101 2e-23 KXL42721.1 hypothetical protein FE78DRAFT_93418 [Acidomyces rich... 101 2e-23 KXT05883.1 hypothetical protein AC578_348 [Mycosphaerella eumusae] 102 2e-23 XP_003855247.1 hypothetical protein MYCGRDRAFT_103502 [Zymosepto... 100 5e-23 XP_007777055.1 UV excision repair protein Rad23 [Coniosporium ap... 100 6e-23 GAM83620.1 hypothetical protein ANO11243_016080 [fungal sp. No.1... 99 1e-22 KJX98695.1 UV excision repair protein Rad23 [Zymoseptoria brevis] 99 2e-22 OCL04082.1 UV excision repair protein Rad23 [Glonium stellatum] 98 2e-22 OCK95578.1 UV excision repair protein Rad23 [Cenococcum geophilu... 97 9e-22 KFX89566.1 hypothetical protein V490_06942 [Pseudogymnoascus sp.... 88 5e-21 XP_008023898.1 hypothetical protein SETTUDRAFT_168371 [Setosphae... 94 6e-21 XP_001933868.1 DNA repair protein RAD23-like protein [Pyrenophor... 94 8e-21 >XP_016763620.1 UV excision repair protein Rad23 [Sphaerulina musiva SO2202] EMF15499.1 UV excision repair protein Rad23 [Sphaerulina musiva SO2202] Length = 392 Score = 109 bits (273), Expect = 1e-26 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIGAVK KISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPSETIGAVKGKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >XP_007676024.1 hypothetical protein BAUCODRAFT_33528 [Baudoinia panamericana UAMH 10762] EMC96189.1 hypothetical protein BAUCODRAFT_33528 [Baudoinia panamericana UAMH 10762] Length = 392 Score = 104 bits (260), Expect = 9e-25 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIGA+K KIS EKGW+PSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPSETIGALKRKISEEKGWEPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >EME48123.1 hypothetical protein DOTSEDRAFT_69906 [Dothistroma septosporum NZE10] Length = 402 Score = 103 bits (257), Expect = 3e-24 Identities = 50/54 (92%), Positives = 51/54 (94%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSE IG VK KISAEKGW+PSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPSEKIGQVKEKISAEKGWEPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >XP_013347610.1 hypothetical protein AUEXF2481DRAFT_76980 [Aureobasidium subglaciale EXF-2481] KEQ99126.1 hypothetical protein AUEXF2481DRAFT_76980 [Aureobasidium subglaciale EXF-2481] Length = 378 Score = 102 bits (255), Expect = 4e-24 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VKAKI++EKGW+PSTQKLIYSGKILQDD T+ESYKIEEKGFIVCM Sbjct: 17 AEPSETIGEVKAKIASEKGWEPSTQKLIYSGKILQDDKTVESYKIEEKGFIVCM 70 >KEQ79540.1 UV excision repair protein Rad23 [Aureobasidium pullulans EXF-150] Length = 379 Score = 102 bits (255), Expect = 4e-24 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VK+KIS+EKGW+PSTQKLIYSGKILQDD T+ESYKIEEKGFIVCM Sbjct: 17 AEPSETIGEVKSKISSEKGWEPSTQKLIYSGKILQDDKTVESYKIEEKGFIVCM 70 >XP_007922943.1 hypothetical protein MYCFIDRAFT_119289, partial [Pseudocercospora fijiensis CIRAD86] EME85282.1 hypothetical protein MYCFIDRAFT_119289, partial [Pseudocercospora fijiensis CIRAD86] Length = 390 Score = 102 bits (254), Expect = 7e-24 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP++TIG+VK KIS EKGW+PSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPTDTIGSVKEKISKEKGWEPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >KEQ65140.1 UV excision repair protein Rad23 [Aureobasidium melanogenum CBS 110374] Length = 376 Score = 101 bits (252), Expect = 1e-23 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VK+KI++EKGW+PSTQKLIYSGKILQDD T+ESYKIEEKGFIVCM Sbjct: 17 AEPSETIGEVKSKIASEKGWEPSTQKLIYSGKILQDDKTVESYKIEEKGFIVCM 70 >XP_013431255.1 UV excision repair protein Rad23 [Aureobasidium namibiae CBS 147.97] KEQ77220.1 UV excision repair protein Rad23 [Aureobasidium namibiae CBS 147.97] Length = 380 Score = 101 bits (252), Expect = 1e-23 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VK+KI++EKGW+PSTQKLIYSGKILQDD T+ESYKIEEKGFIVCM Sbjct: 17 AEPSETIGEVKSKIASEKGWEPSTQKLIYSGKILQDDKTVESYKIEEKGFIVCM 70 >KXT17389.1 hypothetical protein AC579_3856 [Pseudocercospora musae] Length = 387 Score = 101 bits (251), Expect = 2e-23 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP++TIG+VK KIS +KGW+PSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPTDTIGSVKEKISQDKGWEPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >KXL42721.1 hypothetical protein FE78DRAFT_93418 [Acidomyces richmondensis] KYG49472.1 hypothetical protein M433DRAFT_149977 [Acidomyces richmondensis BFW] Length = 390 Score = 101 bits (251), Expect = 2e-23 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP+ETIGAVK KIS EKGW+P+ QKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPTETIGAVKEKISKEKGWEPAQQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >KXT05883.1 hypothetical protein AC578_348 [Mycosphaerella eumusae] Length = 1562 Score = 102 bits (254), Expect = 2e-23 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP++TIG+VK KIS EKGW+PSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPTDTIGSVKEKISQEKGWEPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >XP_003855247.1 hypothetical protein MYCGRDRAFT_103502 [Zymoseptoria tritici IPO323] EGP90223.1 hypothetical protein MYCGRDRAFT_103502 [Zymoseptoria tritici IPO323] Length = 394 Score = 100 bits (248), Expect = 5e-23 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG +K+KI +EKGW+ STQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPSETIGTLKSKIESEKGWETSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >XP_007777055.1 UV excision repair protein Rad23 [Coniosporium apollinis CBS 100218] EON61738.1 UV excision repair protein Rad23 [Coniosporium apollinis CBS 100218] Length = 379 Score = 99.8 bits (247), Expect = 6e-23 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VKAKISAEKGW+PS QKLIYSGKILQD NT+ESY IEEKGFIVCM Sbjct: 17 AEPSETIGDVKAKISAEKGWEPSLQKLIYSGKILQDANTVESYNIEEKGFIVCM 70 >GAM83620.1 hypothetical protein ANO11243_016080 [fungal sp. No.11243] Length = 423 Score = 99.4 bits (246), Expect = 1e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIG VK+KI+AEKGW+ STQKLIYSGKILQDD T+ESYKIEEKGFIVCM Sbjct: 60 AEPSETIGDVKSKIAAEKGWEASTQKLIYSGKILQDDKTVESYKIEEKGFIVCM 113 >KJX98695.1 UV excision repair protein Rad23 [Zymoseptoria brevis] Length = 394 Score = 98.6 bits (244), Expect = 2e-22 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP+ETIG +K KI++EKGW+ STQKLIYSGKILQDDNTIESYKIEEKGFIVCM Sbjct: 17 AEPTETIGGLKQKIASEKGWEASTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 70 >OCL04082.1 UV excision repair protein Rad23 [Glonium stellatum] Length = 390 Score = 98.2 bits (243), Expect = 2e-22 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETI VKAKI+AEKGWDPS QKLIYSGKILQD NT+ESY IEEKGF+VCM Sbjct: 17 AEPSETIADVKAKIAAEKGWDPSLQKLIYSGKILQDSNTVESYNIEEKGFVVCM 70 >OCK95578.1 UV excision repair protein Rad23 [Cenococcum geophilum 1.58] Length = 389 Score = 96.7 bits (239), Expect = 9e-22 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETI VKAKI+AEKGW+PS QKLIYSGKILQD NT+ESY IEEKGF+VCM Sbjct: 17 AEPSETIADVKAKIAAEKGWEPSLQKLIYSGKILQDSNTVESYNIEEKGFVVCM 70 >KFX89566.1 hypothetical protein V490_06942 [Pseudogymnoascus sp. VKM F-3557] Length = 86 Score = 88.2 bits (217), Expect = 5e-21 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEP+E I VKAKI EKGW+ + QKLIYSGKILQD NT+ESYKIEEKGFIVCM Sbjct: 17 AEPTELISDVKAKIEKEKGWEAAQQKLIYSGKILQDANTVESYKIEEKGFIVCM 70 >XP_008023898.1 hypothetical protein SETTUDRAFT_168371 [Setosphaeria turcica Et28A] EOA88493.1 hypothetical protein SETTUDRAFT_168371 [Setosphaeria turcica Et28A] Length = 380 Score = 94.4 bits (233), Expect = 6e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIGA+K+KI AEKGWD QKLIYSGKILQD NT+ESY IEEKGFIVCM Sbjct: 17 AEPSETIGALKSKIQAEKGWDVPQQKLIYSGKILQDANTVESYNIEEKGFIVCM 70 >XP_001933868.1 DNA repair protein RAD23-like protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU46373.1 DNA repair protein RAD23-like protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 382 Score = 94.0 bits (232), Expect = 8e-21 Identities = 45/54 (83%), Positives = 48/54 (88%) Frame = +1 Query: 1 AEPSETIGAVKAKISAEKGWDPSTQKLIYSGKILQDDNTIESYKIEEKGFIVCM 162 AEPSETIGA+KAKI AEKGW+ QKLIYSGKILQD NT+ESY IEEKGFIVCM Sbjct: 17 AEPSETIGALKAKIQAEKGWEVPQQKLIYSGKILQDANTVESYNIEEKGFIVCM 70