BLASTX nr result
ID: Phellodendron21_contig00027879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027879 (747 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003332146.2 hypothetical protein PGTG_13513 [Puccinia gramini... 57 9e-06 >XP_003332146.2 hypothetical protein PGTG_13513 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP87727.2 hypothetical protein PGTG_13513 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 343 Score = 56.6 bits (135), Expect = 9e-06 Identities = 42/115 (36%), Positives = 51/115 (44%), Gaps = 25/115 (21%) Frame = -1 Query: 324 VAQPLELSPSDLAAGGSPEVN-KGKGKQHEVQ---PGVESRILDPAPEGPGM-------- 181 V P + S S L S N KGKGK E P E + P P + Sbjct: 229 VHSPGKSSSSTLPTNTSSSKNCKGKGKAKEEPNPLPSPEDLLSITIPPTPTLFDKSSTIG 288 Query: 180 NPVLDLPLMLT-------------WIQCPVKDCQGPKGDLLAKKGTKTAPWELFV 55 NP L L+ WI+CPVK C+G KGDLLA G++ APWE+FV Sbjct: 289 NPTLPTDSKLSTKLPKGSSASFVSWIKCPVKGCRGAKGDLLAPPGSQNAPWEMFV 343