BLASTX nr result
ID: Phellodendron21_contig00027855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027855 (985 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY13050.1 MATE efflux family protein ALF5 [Theobroma cacao] 45 6e-06 >EOY13050.1 MATE efflux family protein ALF5 [Theobroma cacao] Length = 576 Score = 45.4 bits (106), Expect(2) = 6e-06 Identities = 19/25 (76%), Positives = 24/25 (96%) Frame = +2 Query: 692 SSLEYWAYEILIFLAGLMSNSELTT 766 +SLE+WA+EIL+FLAGLM NSE+TT Sbjct: 365 ASLEFWAFEILVFLAGLMPNSEITT 389 Score = 33.9 bits (76), Expect(2) = 6e-06 Identities = 18/37 (48%), Positives = 25/37 (67%) Frame = +3 Query: 480 HMSFVKKK*AYLRGFSFESFNFIITILKLALPSTAIV 590 ++ F KK +G S ESF++I+ LKLALPS A+V Sbjct: 315 YVIFAKKFENTWKGLSSESFHYILRNLKLALPSAAMV 351