BLASTX nr result
ID: Phellodendron21_contig00027841
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027841 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO68525.1 hypothetical protein CISIN_1g013534mg [Citrus sinensi... 71 2e-12 XP_006443904.1 hypothetical protein CICLE_v10020170mg [Citrus cl... 71 2e-12 OAY49810.1 hypothetical protein MANES_05G085200 [Manihot esculenta] 63 1e-09 XP_016204715.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 63 2e-09 XP_015969707.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 63 2e-09 XP_002275598.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vit... 62 2e-09 XP_017627538.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-09 XP_012490654.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-09 CDP03700.1 unnamed protein product [Coffea canephora] 62 3e-09 XP_017627537.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-09 XP_012490653.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-09 KHG11149.1 E3 ubiquitin ligase DRIP2 -like protein [Gossypium ar... 62 3e-09 KJB80574.1 hypothetical protein B456_013G104800 [Gossypium raimo... 61 5e-09 EOX94566.1 DREB2A-interacting protein 2 isoform 3, partial [Theo... 61 5e-09 KJB80573.1 hypothetical protein B456_013G104800 [Gossypium raimo... 61 5e-09 EOX94565.1 DREB2A-interacting protein 2 isoform 2, partial [Theo... 61 5e-09 XP_007050407.2 PREDICTED: E3 ubiquitin protein ligase DRIP2 [The... 61 5e-09 XP_016746740.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 61 5e-09 XP_016724990.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 61 5e-09 XP_012464022.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 61 5e-09 >KDO68525.1 hypothetical protein CISIN_1g013534mg [Citrus sinensis] KDO68526.1 hypothetical protein CISIN_1g013534mg [Citrus sinensis] KDO68527.1 hypothetical protein CISIN_1g013534mg [Citrus sinensis] Length = 441 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 163 MASNNLVVKVKRETIAACMTCPICNKLLREATTISE 270 MASNNLVVKVKRETIAACMTCPICN LLR+ATTISE Sbjct: 7 MASNNLVVKVKRETIAACMTCPICNTLLRDATTISE 42 >XP_006443904.1 hypothetical protein CICLE_v10020170mg [Citrus clementina] XP_006443905.1 hypothetical protein CICLE_v10020170mg [Citrus clementina] XP_006479583.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Citrus sinensis] XP_006479584.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Citrus sinensis] XP_015386359.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Citrus sinensis] ESR57144.1 hypothetical protein CICLE_v10020170mg [Citrus clementina] ESR57145.1 hypothetical protein CICLE_v10020170mg [Citrus clementina] Length = 441 Score = 71.2 bits (173), Expect = 2e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 163 MASNNLVVKVKRETIAACMTCPICNKLLREATTISE 270 MASNNLVVKVKRETIAACMTCPICN LLR+ATTISE Sbjct: 7 MASNNLVVKVKRETIAACMTCPICNTLLRDATTISE 42 >OAY49810.1 hypothetical protein MANES_05G085200 [Manihot esculenta] Length = 431 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKRETIAACMTCPLCNKLLRDATTISE 34 >XP_016204715.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] XP_016204716.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] XP_016204717.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] Length = 430 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRETIAACMTCP+CNKL REATTISE Sbjct: 3 NRVVKVKRETIAACMTCPLCNKLFREATTISE 34 >XP_015969707.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis duranensis] XP_015969708.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis duranensis] Length = 430 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRETIAACMTCP+CNKL REATTISE Sbjct: 3 NRVVKVKRETIAACMTCPLCNKLFREATTISE 34 >XP_002275598.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vitis vinifera] XP_010651942.1 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Vitis vinifera] CBI17948.3 unnamed protein product, partial [Vitis vinifera] Length = 430 Score = 62.4 bits (150), Expect = 2e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 172 NNLVVKVKRETIAACMTCPICNKLLREATTISE 270 +N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 2 SNQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >XP_017627538.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Gossypium arboreum] Length = 366 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >XP_012490654.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Gossypium raimondii] KJB42217.1 hypothetical protein B456_007G142500 [Gossypium raimondii] Length = 366 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >CDP03700.1 unnamed protein product [Coffea canephora] Length = 428 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 172 NNLVVKVKRETIAACMTCPICNKLLREATTISE 270 +N VVKVKRETIAACMTCP+CNKL R+ATTISE Sbjct: 2 SNQVVKVKRETIAACMTCPLCNKLFRDATTISE 34 >XP_017627537.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Gossypium arboreum] Length = 430 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >XP_012490653.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Gossypium raimondii] KJB42216.1 hypothetical protein B456_007G142500 [Gossypium raimondii] Length = 430 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >KHG11149.1 E3 ubiquitin ligase DRIP2 -like protein [Gossypium arboreum] Length = 430 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKV+RETIAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVRRETIAACMTCPLCNKLLRDATTISE 34 >KJB80574.1 hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 331 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >EOX94566.1 DREB2A-interacting protein 2 isoform 3, partial [Theobroma cacao] Length = 380 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >KJB80573.1 hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 385 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >EOX94565.1 DREB2A-interacting protein 2 isoform 2, partial [Theobroma cacao] Length = 421 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >XP_007050407.2 PREDICTED: E3 ubiquitin protein ligase DRIP2 [Theobroma cacao] Length = 429 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >XP_016746740.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium hirsutum] Length = 429 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >XP_016724990.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium hirsutum] XP_016724992.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium hirsutum] Length = 429 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34 >XP_012464022.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium raimondii] XP_012464023.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Gossypium raimondii] KJB80572.1 hypothetical protein B456_013G104800 [Gossypium raimondii] Length = 429 Score = 61.2 bits (147), Expect = 5e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 175 NLVVKVKRETIAACMTCPICNKLLREATTISE 270 N VVKVKRE IAACMTCP+CNKLLR+ATTISE Sbjct: 3 NQVVKVKREAIAACMTCPLCNKLLRDATTISE 34