BLASTX nr result
ID: Phellodendron21_contig00027695
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027695 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXS95042.1 hypothetical protein AC578_129, partial [Mycosphaerel... 102 8e-24 >KXS95042.1 hypothetical protein AC578_129, partial [Mycosphaerella eumusae] Length = 330 Score = 102 bits (253), Expect = 8e-24 Identities = 48/71 (67%), Positives = 52/71 (73%) Frame = +1 Query: 109 DLSIHEAVLSDHTGYPEAKCRAQPWRRQIYALSSQDDAVDQLVRGGEVYXXXXXXXXXXX 288 DLSIH+ +LSDHTGYPE K RAQPW+RQ YALSSQDDAVDQLVRGGE Y Sbjct: 14 DLSIHQDILSDHTGYPETKFRAQPWKRQTYALSSQDDAVDQLVRGGEFYGAGTGGRGPVQ 73 Query: 289 XXNCYSAGTGG 321 CY+AGTGG Sbjct: 74 GGECYAAGTGG 84