BLASTX nr result
ID: Phellodendron21_contig00027647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027647 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006482263.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 85 3e-18 XP_006430791.1 hypothetical protein CICLE_v10012871mg [Citrus cl... 85 3e-18 KJB43040.1 hypothetical protein B456_007G180900 [Gossypium raimo... 82 3e-17 XP_017628021.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 82 3e-17 XP_016701495.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 82 3e-17 XP_012491281.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 82 3e-17 KHG04519.1 30S ribosomal protein 3, chloroplastic [Gossypium arb... 82 3e-17 OMP09448.1 Ribosomal protein PSRP-3/Ycf65 [Corchorus olitorius] 80 1e-16 XP_007033289.2 PREDICTED: 30S ribosomal protein 3, chloroplastic... 81 2e-16 EOY04215.1 Ribosomal protein PSRP-3/Ycf65 [Theobroma cacao] 81 2e-16 KHG04518.1 30S ribosomal protein 3, chloroplastic [Gossypium arb... 79 6e-16 XP_015880538.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 79 7e-16 AFK42337.1 unknown [Lotus japonicus] 75 9e-16 GAV75658.1 PSRP-3_Ycf65 domain-containing protein, partial [Ceph... 79 1e-15 XP_010692887.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 78 1e-15 XP_010103797.1 30S ribosomal protein 3 [Morus notabilis] EXB9715... 78 2e-15 XP_004304135.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 78 2e-15 XP_009357057.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 78 2e-15 XP_008379540.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 78 2e-15 XP_008230398.1 PREDICTED: 30S ribosomal protein 3, chloroplastic... 78 2e-15 >XP_006482263.1 PREDICTED: 30S ribosomal protein 3, chloroplastic [Citrus sinensis] KDO58991.1 hypothetical protein CISIN_1g029878mg [Citrus sinensis] Length = 186 Score = 85.1 bits (209), Expect = 3e-18 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLL+SKPWISQTERI+LLNQATDVIN WQTSGGNL Sbjct: 142 DAWEELKVLLDSKPWISQTERIHLLNQATDVINFWQTSGGNL 183 >XP_006430791.1 hypothetical protein CICLE_v10012871mg [Citrus clementina] ESR44031.1 hypothetical protein CICLE_v10012871mg [Citrus clementina] Length = 186 Score = 85.1 bits (209), Expect = 3e-18 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLL+SKPWISQTERI+LLNQATDVIN WQTSGGNL Sbjct: 142 DAWEELKVLLDSKPWISQTERIHLLNQATDVINFWQTSGGNL 183 >KJB43040.1 hypothetical protein B456_007G180900 [Gossypium raimondii] Length = 168 Score = 82.0 bits (201), Expect = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 126 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGNL 167 >XP_017628021.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Gossypium arboreum] Length = 169 Score = 82.0 bits (201), Expect = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 127 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGNL 168 >XP_016701495.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Gossypium hirsutum] Length = 169 Score = 82.0 bits (201), Expect = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 127 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGNL 168 >XP_012491281.1 PREDICTED: 30S ribosomal protein 3, chloroplastic [Gossypium raimondii] KJB43039.1 hypothetical protein B456_007G180900 [Gossypium raimondii] Length = 169 Score = 82.0 bits (201), Expect = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 127 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGNL 168 >KHG04519.1 30S ribosomal protein 3, chloroplastic [Gossypium arboreum] Length = 169 Score = 82.0 bits (201), Expect = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 127 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGNL 168 >OMP09448.1 Ribosomal protein PSRP-3/Ycf65 [Corchorus olitorius] Length = 170 Score = 80.5 bits (197), Expect = 1e-16 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGN 239 DAWEELKVLLESKPWIS +RINLLN ATD+INLWQTSGGN Sbjct: 128 DAWEELKVLLESKPWISHLQRINLLNHATDIINLWQTSGGN 168 >XP_007033289.2 PREDICTED: 30S ribosomal protein 3, chloroplastic isoform X3 [Theobroma cacao] Length = 199 Score = 80.9 bits (198), Expect = 2e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLE+KPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 157 DAWEELKVLLENKPWISHMQRIHLLNQATDIINLWQTSGGNL 198 >EOY04215.1 Ribosomal protein PSRP-3/Ycf65 [Theobroma cacao] Length = 199 Score = 80.9 bits (198), Expect = 2e-16 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLE+KPWIS +RI+LLNQATD+INLWQTSGGNL Sbjct: 157 DAWEELKVLLENKPWISHMQRIHLLNQATDIINLWQTSGGNL 198 >KHG04518.1 30S ribosomal protein 3, chloroplastic [Gossypium arboreum] Length = 167 Score = 78.6 bits (192), Expect = 6e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGN 239 DAWEELKVLLESKPWIS +RI+LLNQATD+INLWQTSGG+ Sbjct: 127 DAWEELKVLLESKPWISHMQRIHLLNQATDIINLWQTSGGD 167 >XP_015880538.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Ziziphus jujuba] Length = 190 Score = 79.0 bits (193), Expect = 7e-16 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ E I LLNQATD+INLWQ SGGNL Sbjct: 148 DAWEELKVLLESKPWISQKEMIILLNQATDIINLWQQSGGNL 189 >AFK42337.1 unknown [Lotus japonicus] Length = 73 Score = 75.5 bits (184), Expect = 9e-16 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELK LLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 31 DAWEELKELLESKPWISQKQMIILLNQATDIINLWQQSGGNL 72 >GAV75658.1 PSRP-3_Ycf65 domain-containing protein, partial [Cephalotus follicularis] Length = 196 Score = 78.6 bits (192), Expect = 1e-15 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAW+ELKVLLESKPWIS +R+NLLNQATDVINLWQ +GGN+ Sbjct: 137 DAWDELKVLLESKPWISPLQRVNLLNQATDVINLWQANGGNI 178 >XP_010692887.1 PREDICTED: 30S ribosomal protein 3, chloroplastic [Beta vulgaris subsp. vulgaris] KMT18532.1 hypothetical protein BVRB_2g026700 [Beta vulgaris subsp. vulgaris] Length = 175 Score = 77.8 bits (190), Expect = 1e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 132 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 173 >XP_010103797.1 30S ribosomal protein 3 [Morus notabilis] EXB97159.1 30S ribosomal protein 3 [Morus notabilis] Length = 181 Score = 77.8 bits (190), Expect = 2e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 139 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 180 >XP_004304135.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 182 Score = 77.8 bits (190), Expect = 2e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 140 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 181 >XP_009357057.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Pyrus x bretschneideri] Length = 189 Score = 77.8 bits (190), Expect = 2e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 147 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 188 >XP_008379540.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Malus domestica] Length = 189 Score = 77.8 bits (190), Expect = 2e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 147 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 188 >XP_008230398.1 PREDICTED: 30S ribosomal protein 3, chloroplastic-like [Prunus mume] Length = 192 Score = 77.8 bits (190), Expect = 2e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 361 DAWEELKVLLESKPWISQTERINLLNQATDVINLWQTSGGNL 236 DAWEELKVLLESKPWISQ + I LLNQATD+INLWQ SGGNL Sbjct: 150 DAWEELKVLLESKPWISQKQMIILLNQATDIINLWQQSGGNL 191