BLASTX nr result
ID: Phellodendron21_contig00027460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027460 (489 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO62188.1 hypothetical protein CISIN_1g028465mg [Citrus sinensis] 61 2e-08 XP_006452501.1 hypothetical protein CICLE_v10009483mg [Citrus cl... 61 2e-08 XP_006474958.1 PREDICTED: mitochondrial import inner membrane tr... 54 9e-06 >KDO62188.1 hypothetical protein CISIN_1g028465mg [Citrus sinensis] Length = 208 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -3 Query: 343 ETNPNS--NPDSSKSIVAVPSVHLGVCLFQFVSDTFKGAVLGSIFGH 209 ETNPN NP+SSK+IVAVPS VCL QF D F GA +GSIFG+ Sbjct: 18 ETNPNPIPNPNSSKAIVAVPSASAAVCLMQFTGDAFAGAFMGSIFGY 64 >XP_006452501.1 hypothetical protein CICLE_v10009483mg [Citrus clementina] ESR65741.1 hypothetical protein CICLE_v10009483mg [Citrus clementina] Length = 208 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = -3 Query: 343 ETNPNS--NPDSSKSIVAVPSVHLGVCLFQFVSDTFKGAVLGSIFGH 209 ETNPN NP+SSK+IVAVPS VCL QF D F GA +GSIFG+ Sbjct: 18 ETNPNPSPNPNSSKAIVAVPSASAAVCLMQFTGDAFAGAFMGSIFGY 64 >XP_006474958.1 PREDICTED: mitochondrial import inner membrane translocase subunit TIM22-2 [Citrus sinensis] Length = 215 Score = 53.9 bits (128), Expect = 9e-06 Identities = 30/54 (55%), Positives = 34/54 (62%), Gaps = 9/54 (16%) Frame = -3 Query: 343 ETNPNS--NPDSSKSIVAVPSVHLGV-------CLFQFVSDTFKGAVLGSIFGH 209 ETNPN NP+SSK+IVAVPS V CL QF D F GA +GSIFG+ Sbjct: 18 ETNPNPSPNPNSSKAIVAVPSASAAVPSASAAVCLMQFTGDAFAGAFMGSIFGY 71