BLASTX nr result
ID: Phellodendron21_contig00027269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027269 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora s... 84 2e-19 >OAL02573.1 hypothetical protein IQ06DRAFT_334208 [Stagonospora sp. SRC1lsM3a] Length = 64 Score = 84.3 bits (207), Expect = 2e-19 Identities = 40/64 (62%), Positives = 45/64 (70%) Frame = +3 Query: 93 MNDMFSTHNLPANSQPPFTAFRGFGSPDYVIRQTRDTASI*ATPMEGHDCAGLRVIMGCW 272 MNDMFSTHNLPA SQ A R FG P YVI +TRDTAS T +GH+CAGL + +GCW Sbjct: 1 MNDMFSTHNLPARSQLLSAALRSFGLPGYVIWRTRDTASFKITTTDGHECAGLGITIGCW 60 Query: 273 STIR 284 S R Sbjct: 61 SITR 64