BLASTX nr result
ID: Phellodendron21_contig00027268
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027268 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007927505.1 hypothetical protein MYCFIDRAFT_183014, partial [... 58 2e-08 XP_003717192.1 hypothetical protein MGG_17186, partial [Magnapor... 52 2e-06 XP_003662808.1 hypothetical protein MYCTH_2133976, partial [Ther... 51 8e-06 >XP_007927505.1 hypothetical protein MYCFIDRAFT_183014, partial [Pseudocercospora fijiensis CIRAD86] EME82045.1 hypothetical protein MYCFIDRAFT_183014, partial [Pseudocercospora fijiensis CIRAD86] Length = 56 Score = 57.8 bits (138), Expect = 2e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 437 NSQDESEVEKEAS*TPEAQEKKDESQIQVNASHH 336 +SQDESEVEKEAS TPEAQEKKDESQ QVN SH+ Sbjct: 2 SSQDESEVEKEASSTPEAQEKKDESQKQVNDSHY 35 >XP_003717192.1 hypothetical protein MGG_17186, partial [Magnaporthe oryzae 70-15] EHA50873.1 hypothetical protein MGG_17186, partial [Magnaporthe oryzae 70-15] Length = 62 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 458 PANSSKQNSQDESEVEKEAS*TPEAQEKKDESQIQVNASHHL 333 P SS QDES+VEKE S TP+AQEKKDES +Q+N S L Sbjct: 1 PQTSSPNKVQDESQVEKEESTTPQAQEKKDESSLQINDSSSL 42 >XP_003662808.1 hypothetical protein MYCTH_2133976, partial [Thermothelomyces thermophila ATCC 42464] AEO57563.1 hypothetical protein MYCTH_2133976, partial [Thermothelomyces thermophila ATCC 42464] Length = 55 Score = 50.8 bits (120), Expect = 8e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -2 Query: 449 SSKQNSQDESEVEKEAS*TPEAQEKKDESQIQVNASHH 336 SS+ QDESEVEKEA P+AQEKKDE +Q+NA H Sbjct: 3 SSRSYIQDESEVEKEARSPPQAQEKKDEGAVQINAQRH 40