BLASTX nr result
ID: Phellodendron21_contig00027249
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027249 (466 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY29740.1 hypothetical protein MANES_15G168500 [Manihot esculenta] 88 2e-20 BAH20421.1 AT5G46630, partial [Arabidopsis thaliana] 88 2e-19 JAT50755.1 AP-2 complex subunit mu, partial [Anthurium amnicola] 88 3e-19 CBI69756.1 clathrin family protein, partial [Selaginella pallesc... 85 4e-19 XP_016488814.1 PREDICTED: AP-2 complex subunit mu-like [Nicotian... 88 2e-18 GAU42890.1 hypothetical protein TSUD_232000 [Trifolium subterran... 88 6e-18 XP_010481430.1 PREDICTED: AP-2 complex subunit mu-like [Camelina... 88 7e-18 XP_009397662.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Mu... 88 9e-18 KRH04334.1 hypothetical protein GLYMA_17G155100 [Glycine max] 88 1e-17 XP_006579975.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Gl... 88 1e-17 KRH28284.1 hypothetical protein GLYMA_11G042800 [Glycine max] 88 1e-17 KRH04336.1 hypothetical protein GLYMA_17G155100 [Glycine max] 88 1e-17 XP_008799383.1 PREDICTED: AP-2 complex subunit mu-like isoform X... 88 1e-17 XP_008341081.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Ma... 88 1e-17 EEF42435.1 clathrin coat associated protein ap-50, putative [Ric... 88 1e-17 KRH28285.1 hypothetical protein GLYMA_11G042800 [Glycine max] 88 1e-17 KVH95217.1 Clathrin adaptor, mu subunit [Cynara cardunculus var.... 88 1e-17 KHG25485.1 AP-2 complex subunit mu [Gossypium arboreum] 88 1e-17 XP_015959058.1 PREDICTED: AP-2 complex subunit mu [Arachis duran... 88 1e-17 KJB39799.1 hypothetical protein B456_007G031400 [Gossypium raimo... 88 1e-17 >OAY29740.1 hypothetical protein MANES_15G168500 [Manihot esculenta] Length = 58 Score = 88.2 bits (217), Expect = 2e-20 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 19 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 58 >BAH20421.1 AT5G46630, partial [Arabidopsis thaliana] Length = 133 Score = 88.2 bits (217), Expect = 2e-19 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 94 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 133 >JAT50755.1 AP-2 complex subunit mu, partial [Anthurium amnicola] Length = 165 Score = 88.2 bits (217), Expect = 3e-19 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 126 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 165 >CBI69756.1 clathrin family protein, partial [Selaginella pallescens] Length = 67 Score = 85.1 bits (209), Expect = 4e-19 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGY+TVEWVRYIT+AGSYEIRC Sbjct: 28 PMFTASGLRVRFLKVWEKSGYSTVEWVRYITRAGSYEIRC 67 >XP_016488814.1 PREDICTED: AP-2 complex subunit mu-like [Nicotiana tabacum] XP_016488815.1 PREDICTED: AP-2 complex subunit mu-like [Nicotiana tabacum] Length = 261 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 222 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 261 >GAU42890.1 hypothetical protein TSUD_232000 [Trifolium subterraneum] Length = 319 Score = 88.2 bits (217), Expect = 6e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 280 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 319 >XP_010481430.1 PREDICTED: AP-2 complex subunit mu-like [Camelina sativa] Length = 334 Score = 88.2 bits (217), Expect = 7e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 295 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 334 >XP_009397662.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Musa acuminata subsp. malaccensis] Length = 360 Score = 88.2 bits (217), Expect = 9e-18 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 321 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 360 >KRH04334.1 hypothetical protein GLYMA_17G155100 [Glycine max] Length = 399 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 360 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 399 >XP_006579975.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Glycine max] KRH58202.1 hypothetical protein GLYMA_05G111900 [Glycine max] Length = 399 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 360 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 399 >KRH28284.1 hypothetical protein GLYMA_11G042800 [Glycine max] Length = 362 Score = 87.8 bits (216), Expect = 1e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYE+RC Sbjct: 323 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEVRC 362 >KRH04336.1 hypothetical protein GLYMA_17G155100 [Glycine max] Length = 408 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 369 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 408 >XP_008799383.1 PREDICTED: AP-2 complex subunit mu-like isoform X2 [Phoenix dactylifera] Length = 408 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 369 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 408 >XP_008341081.1 PREDICTED: AP-2 complex subunit mu isoform X2 [Malus domestica] Length = 408 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 369 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 408 >EEF42435.1 clathrin coat associated protein ap-50, putative [Ricinus communis] Length = 408 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 369 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 408 >KRH28285.1 hypothetical protein GLYMA_11G042800 [Glycine max] Length = 365 Score = 87.8 bits (216), Expect = 1e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYE+RC Sbjct: 326 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEVRC 365 >KVH95217.1 Clathrin adaptor, mu subunit [Cynara cardunculus var. scolymus] Length = 427 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 388 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 427 >KHG25485.1 AP-2 complex subunit mu [Gossypium arboreum] Length = 430 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 391 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 430 >XP_015959058.1 PREDICTED: AP-2 complex subunit mu [Arachis duranensis] Length = 434 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 395 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 434 >KJB39799.1 hypothetical protein B456_007G031400 [Gossypium raimondii] Length = 437 Score = 88.2 bits (217), Expect = 1e-17 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 466 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 347 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC Sbjct: 398 PMFTASGLRVRFLKVWEKSGYNTVEWVRYITKAGSYEIRC 437