BLASTX nr result
ID: Phellodendron21_contig00027099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027099 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW13492.1 hypothetical protein TanjilG_01060 [Lupinus angustifo... 57 2e-08 >OIW13492.1 hypothetical protein TanjilG_01060 [Lupinus angustifolius] Length = 99 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 116 KRECVFPASMQELPGPGTRAILDPTKTCHEQ 24 KRE VFPASMQ+LPGPG RAIL PTK CHEQ Sbjct: 8 KREFVFPASMQKLPGPGKRAILGPTKPCHEQ 38