BLASTX nr result
ID: Phellodendron21_contig00027056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00027056 (351 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO64095.1 hypothetical protein CISIN_1g011714mg [Citrus sinensis] 89 2e-18 XP_006481194.2 PREDICTED: pentatricopeptide repeat-containing pr... 54 4e-06 >KDO64095.1 hypothetical protein CISIN_1g011714mg [Citrus sinensis] Length = 479 Score = 89.0 bits (219), Expect = 2e-18 Identities = 44/76 (57%), Positives = 60/76 (78%), Gaps = 2/76 (2%) Frame = -2 Query: 233 SLLLSHSFIFTNTNRKNHSSVPQLNKL--FATVASSTEQSLDFNESPRNLLAQKFINTIK 60 SL+ S+SFIFTNTNR+NH+ +PQ NKL FA + ST +SLD E+PR+L AQ+F++ IK Sbjct: 3 SLVPSNSFIFTNTNRRNHNKIPQFNKLVVFAAASLSTAESLDLKENPRSLQAQRFVDRIK 62 Query: 59 ALPLKDRSDICNNMKK 12 A PLK+R DI +++KK Sbjct: 63 ASPLKERIDIFDSIKK 78 >XP_006481194.2 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like, partial [Citrus sinensis] Length = 454 Score = 54.3 bits (129), Expect = 4e-06 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 2/52 (3%) Frame = -2 Query: 161 NKL--FATVASSTEQSLDFNESPRNLLAQKFINTIKALPLKDRSDICNNMKK 12 NKL FA + ST +SLD E+PR+L AQ+F++ IKA PLK+R DI +++KK Sbjct: 2 NKLVVFAAASLSTAESLDLKENPRSLQAQRFVDRIKASPLKERIDIFDSIKK 53