BLASTX nr result
ID: Phellodendron21_contig00026991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026991 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412939.1 hypothetical protein MELLADRAFT_89915 [Melampsora... 74 1e-12 >XP_007412939.1 hypothetical protein MELLADRAFT_89915 [Melampsora larici-populina 98AG31] EGG03825.1 hypothetical protein MELLADRAFT_89915 [Melampsora larici-populina 98AG31] Length = 408 Score = 74.3 bits (181), Expect = 1e-12 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 3/75 (4%) Frame = +1 Query: 172 RRVFLPTHFVCDPNLNSNYLSRRPVSK---CQDLEGATSIIITTLDKQVLKVRTDLIGYD 342 RRVFL THFV DP N+NYL+ RP + ++L+ T I++T LD + LK++T+L+G Sbjct: 331 RRVFLRTHFVKDPRYNTNYLTTRPKVEEYESEELKNPTRIVLTKLDSKGLKIQTELLGVS 390 Query: 343 AHTGEKVSRTLSTRS 387 TGEK+ RT+ST+S Sbjct: 391 LITGEKICRTMSTQS 405