BLASTX nr result
ID: Phellodendron21_contig00026825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026825 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018826016.1 PREDICTED: serine/arginine-rich SC35-like splicin... 91 4e-20 OAY55924.1 hypothetical protein MANES_03G189500 [Manihot esculenta] 89 5e-20 OAY55923.1 hypothetical protein MANES_03G189500 [Manihot esculenta] 89 2e-19 OAY55922.1 hypothetical protein MANES_03G189500 [Manihot esculenta] 89 2e-19 XP_015888333.1 PREDICTED: serine/arginine-rich SC35-like splicin... 88 3e-19 XP_008223084.1 PREDICTED: serine/arginine-rich SC35-like splicin... 88 3e-19 XP_007227540.1 hypothetical protein PRUPE_ppa010343mg [Prunus pe... 88 3e-19 XP_006419707.1 hypothetical protein CICLE_v10005625mg [Citrus cl... 86 3e-19 XP_008223083.1 PREDICTED: serine/arginine-rich SC35-like splicin... 88 3e-19 XP_007227541.1 hypothetical protein PRUPE_ppa010343mg [Prunus pe... 88 3e-19 OMO53757.1 hypothetical protein CCACVL1_28376 [Corchorus capsula... 88 5e-19 XP_006419706.1 hypothetical protein CICLE_v10005625mg [Citrus cl... 86 5e-19 XP_007035427.2 PREDICTED: serine/arginine-rich SC35-like splicin... 88 5e-19 EOY06353.1 SC35-like splicing factor 28 isoform 2 [Theobroma cacao] 88 5e-19 EOY06352.1 SC35-like splicing factor 28 isoform 1 [Theobroma cacao] 88 7e-19 XP_006419722.1 hypothetical protein CICLE_v10005625mg [Citrus cl... 86 1e-18 XP_008438778.1 PREDICTED: serine/arginine-rich SC35-like splicin... 87 1e-18 XP_004134179.1 PREDICTED: serine/arginine-rich SC35-like splicin... 87 1e-18 XP_010105669.1 Serine/arginine-rich splicing factor 12 [Morus no... 87 1e-18 GAV63376.1 RRM_1 domain-containing protein [Cephalotus follicula... 87 1e-18 >XP_018826016.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 [Juglans regia] Length = 250 Score = 90.5 bits (223), Expect = 4e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDARTEDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARTEDLRIPFERYGPVKDVYLPKNYYTGE 89 >OAY55924.1 hypothetical protein MANES_03G189500 [Manihot esculenta] Length = 185 Score = 88.6 bits (218), Expect = 5e-20 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 49 PAPSGLLVRNLPLDARPEDLRVPFEKYGPVKDVYLPKNYYTGE 91 >OAY55923.1 hypothetical protein MANES_03G189500 [Manihot esculenta] Length = 257 Score = 88.6 bits (218), Expect = 2e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 49 PAPSGLLVRNLPLDARPEDLRVPFEKYGPVKDVYLPKNYYTGE 91 >OAY55922.1 hypothetical protein MANES_03G189500 [Manihot esculenta] Length = 259 Score = 88.6 bits (218), Expect = 2e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 49 PAPSGLLVRNLPLDARPEDLRVPFEKYGPVKDVYLPKNYYTGE 91 >XP_015888333.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 [Ziziphus jujuba] Length = 252 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 48 PAPSGLLVRNLPLDARPEDLRIPFERYGPVKDVYLPKNYYTGE 90 >XP_008223084.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 isoform X2 [Prunus mume] Length = 252 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERYGPVKDVYLPKNYYTGE 89 >XP_007227540.1 hypothetical protein PRUPE_ppa010343mg [Prunus persica] ONI28503.1 hypothetical protein PRUPE_1G144400 [Prunus persica] Length = 252 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERYGPVKDVYLPKNYYTGE 89 >XP_006419707.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419710.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419712.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419715.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419719.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419720.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32947.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32950.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32952.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32955.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32959.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32960.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] Length = 169 Score = 86.3 bits (212), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDARTE+LRV FE+YGPVKDVYLPKNYYTGE Sbjct: 40 PAPSGLLVRNLPLDARTEELRVAFERYGPVKDVYLPKNYYTGE 82 >XP_008223083.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 isoform X1 [Prunus mume] Length = 253 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERYGPVKDVYLPKNYYTGE 89 >XP_007227541.1 hypothetical protein PRUPE_ppa010343mg [Prunus persica] Length = 253 Score = 88.2 bits (217), Expect = 3e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE+YGPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERYGPVKDVYLPKNYYTGE 89 >OMO53757.1 hypothetical protein CCACVL1_28376 [Corchorus capsularis] Length = 288 Score = 88.2 bits (217), Expect = 5e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLL+RNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 44 PAPSGLLIRNLPLDARPEDLRVPFERYGPVKDVYLPKNYYTGE 86 >XP_006419706.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419709.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419714.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419716.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419717.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419718.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419721.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] XP_006419723.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32946.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32949.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32954.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32956.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32957.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32958.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32961.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32963.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] Length = 195 Score = 86.3 bits (212), Expect = 5e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDARTE+LRV FE+YGPVKDVYLPKNYYTGE Sbjct: 40 PAPSGLLVRNLPLDARTEELRVAFERYGPVKDVYLPKNYYTGE 82 >XP_007035427.2 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 [Theobroma cacao] Length = 291 Score = 88.2 bits (217), Expect = 5e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLL+RNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 44 PAPSGLLIRNLPLDARPEDLRVPFERYGPVKDVYLPKNYYTGE 86 >EOY06353.1 SC35-like splicing factor 28 isoform 2 [Theobroma cacao] Length = 291 Score = 88.2 bits (217), Expect = 5e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLL+RNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 44 PAPSGLLIRNLPLDARPEDLRVPFERYGPVKDVYLPKNYYTGE 86 >EOY06352.1 SC35-like splicing factor 28 isoform 1 [Theobroma cacao] Length = 308 Score = 88.2 bits (217), Expect = 7e-19 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLL+RNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 44 PAPSGLLIRNLPLDARPEDLRVPFERYGPVKDVYLPKNYYTGE 86 >XP_006419722.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] ESR32962.1 hypothetical protein CICLE_v10005625mg [Citrus clementina] Length = 228 Score = 86.3 bits (212), Expect = 1e-18 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDARTE+LRV FE+YGPVKDVYLPKNYYTGE Sbjct: 40 PAPSGLLVRNLPLDARTEELRVAFERYGPVKDVYLPKNYYTGE 82 >XP_008438778.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 [Cucumis melo] Length = 248 Score = 86.7 bits (213), Expect = 1e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE++GPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERFGPVKDVYLPKNYYTGE 89 >XP_004134179.1 PREDICTED: serine/arginine-rich SC35-like splicing factor SCL28 [Cucumis sativus] Length = 248 Score = 86.7 bits (213), Expect = 1e-18 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR+PFE++GPVKDVYLPKNYYTGE Sbjct: 47 PAPSGLLVRNLPLDARPEDLRIPFERFGPVKDVYLPKNYYTGE 89 >XP_010105669.1 Serine/arginine-rich splicing factor 12 [Morus notabilis] EXC05700.1 Serine/arginine-rich splicing factor 12 [Morus notabilis] Length = 269 Score = 87.0 bits (214), Expect = 1e-18 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 PAP+GLLVRNLPLDAR EDLR PFE+YGPVKDVYLPKNYYTGE Sbjct: 46 PAPSGLLVRNLPLDARPEDLRTPFERYGPVKDVYLPKNYYTGE 88 >GAV63376.1 RRM_1 domain-containing protein [Cephalotus follicularis] Length = 250 Score = 86.7 bits (213), Expect = 1e-18 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -2 Query: 131 PAPTGLLVRNLPLDARTEDLRVPFEQYGPVKDVYLPKNYYTGE 3 P P+GLLVRNLPLDAR EDLRVPFE+YGPVKDVYLPKNYYTGE Sbjct: 44 PLPSGLLVRNLPLDARPEDLRVPFERYGPVKDVYLPKNYYTGE 86