BLASTX nr result
ID: Phellodendron21_contig00026789
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026789 (1247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007418008.1 hypothetical protein MELLADRAFT_95444 [Melampsora... 63 6e-07 >XP_007418008.1 hypothetical protein MELLADRAFT_95444 [Melampsora larici-populina 98AG31] EGF98757.1 hypothetical protein MELLADRAFT_95444 [Melampsora larici-populina 98AG31] Length = 632 Score = 62.8 bits (151), Expect = 6e-07 Identities = 38/97 (39%), Positives = 58/97 (59%), Gaps = 17/97 (17%) Frame = +1 Query: 1 NLEAASQAKKNMEEELENMSIELFEEANRMVRVERIKSVSLETELLELRNKL--PLQSSF 174 +LE +++K+ +E ELE +SIELFEEANRMVR ER+K V LE EL +L+N++ P+ Sbjct: 240 SLENVNESKRQIEGELEKLSIELFEEANRMVRDERMKFVELENELNQLKNQIGKPIDHET 299 Query: 175 RKHR---------------TVYKEEYMPPVTESPERS 240 R+ TV ++ P + ++PER+ Sbjct: 300 REFEESKNSMDSNHTLASCTVTPKKKKPSMIKTPERT 336