BLASTX nr result
ID: Phellodendron21_contig00026760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026760 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404132.1 hypothetical protein MELLADRAFT_86766 [Melampsora... 58 2e-07 >XP_007404132.1 hypothetical protein MELLADRAFT_86766 [Melampsora larici-populina 98AG31] EGG13194.1 hypothetical protein MELLADRAFT_86766 [Melampsora larici-populina 98AG31] Length = 309 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = +2 Query: 242 VPAQFGEAARHATLAGRHAAATSWARSTLKGYSAGLTKFAEFK 370 +P F AA+ A+ AGRHAA+ SWA++TL GYSAG++KF EFK Sbjct: 4 LPGHFQNAAQGASRAGRHAASGSWAKTTLAGYSAGMSKFIEFK 46