BLASTX nr result
ID: Phellodendron21_contig00026619
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026619 (299 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO79398.1 hypothetical protein CISIN_1g030938mg [Citrus sinensis] 63 3e-10 XP_006425787.1 hypothetical protein CICLE_v10026636mg [Citrus cl... 63 3e-10 >KDO79398.1 hypothetical protein CISIN_1g030938mg [Citrus sinensis] Length = 169 Score = 63.2 bits (152), Expect = 3e-10 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 170 TTHFTDRSRLRAMASTISSSLLFQAPSLLRVR-TTHPVSCKAQTPKPAPALHGASRR 3 TTH T +S LRAMASTI S L +AP+LLRVR PV+CKA PK A ALH ASRR Sbjct: 9 TTHLTQKSSLRAMASTIPWSSLSRAPTLLRVRNNARPVTCKAHAPKSAQALH-ASRR 64 >XP_006425787.1 hypothetical protein CICLE_v10026636mg [Citrus clementina] XP_006466682.1 PREDICTED: uncharacterized protein LOC102619151 [Citrus sinensis] ESR39027.1 hypothetical protein CICLE_v10026636mg [Citrus clementina] Length = 169 Score = 63.2 bits (152), Expect = 3e-10 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = -1 Query: 170 TTHFTDRSRLRAMASTISSSLLFQAPSLLRVR-TTHPVSCKAQTPKPAPALHGASRR 3 TTH T +S LRAMASTI S L +AP+LLRVR PV+CKA PK A ALH ASRR Sbjct: 9 TTHLTQKSSLRAMASTIPWSSLSRAPTLLRVRNNARPVTCKAHAPKSAQALH-ASRR 64