BLASTX nr result
ID: Phellodendron21_contig00026581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026581 (517 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006438884.1 hypothetical protein CICLE_v10033235mg [Citrus cl... 105 6e-27 KDO83211.1 hypothetical protein CISIN_1g035469mg [Citrus sinensis] 91 3e-21 OAY36205.1 hypothetical protein MANES_11G003500 [Manihot esculenta] 66 1e-11 XP_007028562.2 PREDICTED: cysteine-rich and transmembrane domain... 63 2e-10 OAY43280.1 hypothetical protein MANES_08G056600 [Manihot esculenta] 62 7e-10 OMO60111.1 hypothetical protein COLO4_33936 [Corchorus olitorius] 62 7e-10 KJB35914.1 hypothetical protein B456_006G133500 [Gossypium raimo... 60 2e-09 XP_006421267.1 hypothetical protein CICLE_v10006402mg [Citrus cl... 60 2e-09 XP_017610545.1 PREDICTED: cysteine-rich and transmembrane domain... 60 3e-09 XP_002871075.1 hypothetical protein ARALYDRAFT_908293 [Arabidops... 60 3e-09 EOY19979.1 Cell wall integrity and stress response component 2, ... 60 3e-09 EEF30889.1 conserved hypothetical protein [Ricinus communis] 60 4e-09 ONH95012.1 hypothetical protein PRUPE_7G046400 [Prunus persica] 60 4e-09 KJB73055.1 hypothetical protein B456_011G212400 [Gossypium raimo... 59 5e-09 GAU17890.1 hypothetical protein TSUD_330160 [Trifolium subterran... 59 5e-09 CBI30080.3 unnamed protein product, partial [Vitis vinifera] 59 7e-09 XP_009764368.1 PREDICTED: cysteine-rich and transmembrane domain... 59 8e-09 XP_019090509.1 PREDICTED: cysteine-rich and transmembrane domain... 59 1e-08 NP_196028.2 cysteine-rich TM module stress tolerance protein [Ar... 59 1e-08 KFK24859.1 hypothetical protein AALP_AA8G034200 [Arabis alpina] 59 1e-08 >XP_006438884.1 hypothetical protein CICLE_v10033235mg [Citrus clementina] XP_006482989.1 PREDICTED: uncharacterized protein LOC102623457 [Citrus sinensis] ESR52124.1 hypothetical protein CICLE_v10033235mg [Citrus clementina] Length = 76 Score = 105 bits (263), Expect = 6e-27 Identities = 51/74 (68%), Positives = 55/74 (74%), Gaps = 3/74 (4%) Frame = -1 Query: 415 AQVPRSSDNNLPMMEHEHVEAHXXXXXXXXXXC---FARTKKKGKDRSFIEGCLFALCCC 245 +QVPRS+D + PMM+HEH EA C FARTKKKG DRSFIEGCLFALCCC Sbjct: 3 SQVPRSADKSQPMMDHEHEEAQRKGGKRKCSMCARGFARTKKKGNDRSFIEGCLFALCCC 62 Query: 244 WICDACFDVTVVTG 203 WICDACFDVTVV G Sbjct: 63 WICDACFDVTVVAG 76 >KDO83211.1 hypothetical protein CISIN_1g035469mg [Citrus sinensis] Length = 62 Score = 90.9 bits (224), Expect = 3e-21 Identities = 44/62 (70%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = -1 Query: 379 MMEHEHVEAHXXXXXXXXXXC---FARTKKKGKDRSFIEGCLFALCCCWICDACFDVTVV 209 MM+HEH EA C FARTKKKG DRSFIEGCLFALCCCWICDACFDVTVV Sbjct: 1 MMDHEHEEAQRKGGKRKCSMCARGFARTKKKGNDRSFIEGCLFALCCCWICDACFDVTVV 60 Query: 208 TG 203 G Sbjct: 61 AG 62 >OAY36205.1 hypothetical protein MANES_11G003500 [Manihot esculenta] Length = 66 Score = 66.2 bits (160), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 307 TKKKGKDRSFIEGCLFALCCCWICDACFDVTVVTG 203 +K KG DRSF+EGCLFALCCCWICD CFD TVV G Sbjct: 33 SKPKG-DRSFLEGCLFALCCCWICDLCFDTTVVIG 66 >XP_007028562.2 PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Theobroma cacao] Length = 56 Score = 62.8 bits (151), Expect = 2e-10 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F+RTKKKG DR FIEGCLFALCCCW+C+ CF Sbjct: 27 FSRTKKKG-DRGFIEGCLFALCCCWLCETCF 56 >OAY43280.1 hypothetical protein MANES_08G056600 [Manihot esculenta] Length = 56 Score = 61.6 bits (148), Expect = 7e-10 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F R+KKKG DR FIEGCLFALCCCW+C+ACF Sbjct: 27 FNRSKKKG-DRGFIEGCLFALCCCWLCEACF 56 >OMO60111.1 hypothetical protein COLO4_33936 [Corchorus olitorius] Length = 58 Score = 61.6 bits (148), Expect = 7e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 310 RTKKKGKDRSFIEGCLFALCCCWICDACF 224 RTKKKG DR FIEGCLFALCCCW+C+ACF Sbjct: 31 RTKKKG-DRGFIEGCLFALCCCWLCEACF 58 >KJB35914.1 hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 60.5 bits (145), Expect = 2e-09 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F R+KKKG DR FIEGCLFALCCCW+C+ CF Sbjct: 31 FPRSKKKG-DRGFIEGCLFALCCCWLCETCF 60 >XP_006421267.1 hypothetical protein CICLE_v10006402mg [Citrus clementina] ESR34507.1 hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 60.5 bits (145), Expect = 2e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 313 ARTKKKGKDRSFIEGCLFALCCCWICDACF 224 ++TKKKG DR FIEGCLFALCCCW+C+ACF Sbjct: 32 SQTKKKG-DRGFIEGCLFALCCCWLCEACF 60 >XP_017610545.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Gossypium arboreum] Length = 76 Score = 60.5 bits (145), Expect = 3e-09 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F R+KKKG DR FIEGCLFALCCCW+C+ CF Sbjct: 47 FPRSKKKG-DRGFIEGCLFALCCCWLCETCF 76 >XP_002871075.1 hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] EFH47334.1 hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 60.1 bits (144), Expect = 3e-09 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F TKKKG DR FIEGCLFALCCCWIC+ CF Sbjct: 35 FFETKKKG-DRGFIEGCLFALCCCWICEMCF 64 >EOY19979.1 Cell wall integrity and stress response component 2, putative [Theobroma cacao] Length = 53 Score = 59.7 bits (143), Expect = 3e-09 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 310 RTKKKGKDRSFIEGCLFALCCCWICDACFDV 218 R K GK+RSF+EGCLFALCCCW+ DACFD+ Sbjct: 23 RDKGTGKNRSFLEGCLFALCCCWLWDACFDL 53 >EEF30889.1 conserved hypothetical protein [Ricinus communis] Length = 56 Score = 59.7 bits (143), Expect = 4e-09 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 307 TKKKGKDRSFIEGCLFALCCCWICDACF 224 TKKKG DR FIEGCLFALCCCW+C+ACF Sbjct: 30 TKKKG-DRGFIEGCLFALCCCWLCEACF 56 >ONH95012.1 hypothetical protein PRUPE_7G046400 [Prunus persica] Length = 58 Score = 59.7 bits (143), Expect = 4e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 310 RTKKKGKDRSFIEGCLFALCCCWICDACF 224 RTKKKG DR FIEGCLFALCCCW+C+ CF Sbjct: 31 RTKKKG-DRGFIEGCLFALCCCWLCEECF 58 >KJB73055.1 hypothetical protein B456_011G212400 [Gossypium raimondii] Length = 55 Score = 59.3 bits (142), Expect = 5e-09 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 310 RTKKKGKDRSFIEGCLFALCCCWICDACFDV 218 R K G++RSF+EGCLFALCCCW+ DACFD+ Sbjct: 25 RNKGNGRNRSFLEGCLFALCCCWLWDACFDL 55 >GAU17890.1 hypothetical protein TSUD_330160 [Trifolium subterraneum] Length = 57 Score = 59.3 bits (142), Expect = 5e-09 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F ++KKKG DR FIEGCLFALCCCWIC+ CF Sbjct: 28 FFKSKKKG-DRGFIEGCLFALCCCWICEECF 57 >CBI30080.3 unnamed protein product, partial [Vitis vinifera] Length = 56 Score = 58.9 bits (141), Expect = 7e-09 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 310 RTKKKGKDRSFIEGCLFALCCCWICDACF 224 R+K KG DR FIEGCLFALCCCWIC+ACF Sbjct: 29 RSKSKG-DRGFIEGCLFALCCCWICEACF 56 >XP_009764368.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 58.9 bits (141), Expect = 8e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACFD 221 F R+K KG +R F+EGCLFALCCCWIC+ CFD Sbjct: 32 FPRSKPKG-ERGFLEGCLFALCCCWICEVCFD 62 >XP_019090509.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B [Camelina sativa] XP_019084530.1 PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like [Camelina sativa] Length = 63 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F TK+KG DR FIEGCLFALCCCWIC+ CF Sbjct: 34 FFETKQKG-DRGFIEGCLFALCCCWICEMCF 63 >NP_196028.2 cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] AAR24695.1 At5g04080 [Arabidopsis thaliana] AAS00338.1 At5g04080 [Arabidopsis thaliana] AED90694.1 cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] OAO95527.1 hypothetical protein AXX17_AT5G03460 [Arabidopsis thaliana] Length = 63 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F TK+KG DR FIEGCLFALCCCWIC+ CF Sbjct: 34 FFETKQKG-DRGFIEGCLFALCCCWICEMCF 63 >KFK24859.1 hypothetical protein AALP_AA8G034200 [Arabis alpina] Length = 67 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 316 FARTKKKGKDRSFIEGCLFALCCCWICDACF 224 F TK+KG DR FIEGCLFALCCCWIC+ CF Sbjct: 38 FFETKEKG-DRGFIEGCLFALCCCWICEMCF 67