BLASTX nr result
ID: Phellodendron21_contig00026390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026390 (399 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414123.1 hypothetical protein MELLADRAFT_117502 [Melampsor... 66 4e-10 >XP_007414123.1 hypothetical protein MELLADRAFT_117502 [Melampsora larici-populina 98AG31] EGG02721.1 hypothetical protein MELLADRAFT_117502 [Melampsora larici-populina 98AG31] Length = 397 Score = 66.2 bits (160), Expect = 4e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 394 IKDKYIRIGHMGLTAVSDCERGDVEKIIDGLRESFKDLGFQAT 266 +KD+YIRIGHMG+TAV D ERGDV++I+ L ESFKDLGFQA+ Sbjct: 356 VKDRYIRIGHMGITAV-DKERGDVDRIVQSLNESFKDLGFQAS 397