BLASTX nr result
ID: Phellodendron21_contig00026283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00026283 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007410007.1 hypothetical protein MELLADRAFT_43430 [Melampsora... 60 1e-07 >XP_007410007.1 hypothetical protein MELLADRAFT_43430 [Melampsora larici-populina 98AG31] EGG06567.1 hypothetical protein MELLADRAFT_43430 [Melampsora larici-populina 98AG31] Length = 1169 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/52 (59%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -1 Query: 156 MSPSTP-YDEKDTIKDVDDGHSDSTPPSIPVGPTSISAPGGISFADEKRPLS 4 MSP TP YDEK D+D S+S P S+P+G S + PGGISFADEKRP+S Sbjct: 1 MSPRTPSYDEKHD--DIDKAESESLPSSLPMGVNSTTVPGGISFADEKRPIS 50