BLASTX nr result
ID: Phellodendron21_contig00025961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025961 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006453252.1 hypothetical protein CICLE_v10009594mg [Citrus cl... 75 8e-15 XP_004301162.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 71 5e-13 GAV84257.1 dCMP_cyt_deam_1 domain-containing protein [Cephalotus... 70 7e-13 XP_008223876.1 PREDICTED: tRNA-specific adenosine deaminase 2 [P... 70 1e-12 XP_007227178.1 hypothetical protein PRUPE_ppa020315mg [Prunus pe... 70 1e-12 XP_018501383.1 PREDICTED: tRNA-specific adenosine deaminase 2 is... 69 3e-12 XP_009349160.2 PREDICTED: tRNA-specific adenosine deaminase 2 is... 69 4e-12 KJB76959.1 hypothetical protein B456_012G114300 [Gossypium raimo... 66 1e-11 XP_014493232.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 67 1e-11 KYP57524.1 tRNA-specific adenosine deaminase 2 [Cajanus cajan] 67 2e-11 XP_017406335.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 67 2e-11 XP_014493231.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 67 2e-11 KHN17632.1 tRNA-specific adenosine deaminase 2 [Glycine soja] 67 2e-11 XP_017409632.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 67 2e-11 XP_008391198.1 PREDICTED: LOW QUALITY PROTEIN: tRNA-specific ade... 66 3e-11 XP_003624730.2 tRNA-specific adenosine deaminase [Medicago trunc... 66 3e-11 XP_016680769.1 PREDICTED: tRNA-specific adenosine deaminase 2-li... 66 4e-11 XP_012460208.1 PREDICTED: tRNA-specific adenosine deaminase 2 [G... 66 4e-11 XP_016574878.1 PREDICTED: tRNA-specific adenosine deaminase 2 [C... 66 4e-11 XP_018836613.1 PREDICTED: tRNA-specific adenosine deaminase 2 [J... 66 4e-11 >XP_006453252.1 hypothetical protein CICLE_v10009594mg [Citrus clementina] XP_006474269.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Citrus sinensis] ESR66492.1 hypothetical protein CICLE_v10009594mg [Citrus clementina] KDO61912.1 hypothetical protein CISIN_1g029549mg [Citrus sinensis] Length = 191 Score = 75.5 bits (184), Expect = 8e-15 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQSMN 199 GG+MASEAVSLFRSFYEQGNPNAPKPHRPL HQ+MN Sbjct: 156 GGVMASEAVSLFRSFYEQGNPNAPKPHRPLVHQAMN 191 >XP_004301162.1 PREDICTED: tRNA-specific adenosine deaminase 2-like [Fragaria vesca subsp. vesca] Length = 195 Score = 70.9 bits (172), Expect = 5e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQSM 202 GGIMASEAVSLFR+FYEQGNPNAPKPHRPL HQ++ Sbjct: 160 GGIMASEAVSLFRNFYEQGNPNAPKPHRPLVHQAI 194 >GAV84257.1 dCMP_cyt_deam_1 domain-containing protein [Cephalotus follicularis] Length = 190 Score = 70.5 bits (171), Expect = 7e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLA+Q+ Sbjct: 155 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLANQT 188 >XP_008223876.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Prunus mume] XP_016647343.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Prunus mume] XP_016647344.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Prunus mume] XP_016647345.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Prunus mume] Length = 191 Score = 70.1 bits (170), Expect = 1e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLA Q+ Sbjct: 156 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAQQA 189 >XP_007227178.1 hypothetical protein PRUPE_ppa020315mg [Prunus persica] ONI27232.1 hypothetical protein PRUPE_1G075100 [Prunus persica] Length = 191 Score = 70.1 bits (170), Expect = 1e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLA Q+ Sbjct: 156 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAQQA 189 >XP_018501383.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Pyrus x bretschneideri] XP_018501384.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X2 [Pyrus x bretschneideri] Length = 191 Score = 68.9 bits (167), Expect = 3e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMA+EAVSLFRSFYEQGNPNAPKPHRPLA Q+ Sbjct: 156 GGIMATEAVSLFRSFYEQGNPNAPKPHRPLAQQA 189 >XP_009349160.2 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X1 [Pyrus x bretschneideri] XP_018501382.1 PREDICTED: tRNA-specific adenosine deaminase 2 isoform X1 [Pyrus x bretschneideri] Length = 219 Score = 68.9 bits (167), Expect = 4e-12 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMA+EAVSLFRSFYEQGNPNAPKPHRPLA Q+ Sbjct: 184 GGIMATEAVSLFRSFYEQGNPNAPKPHRPLAQQA 217 >KJB76959.1 hypothetical protein B456_012G114300 [Gossypium raimondii] Length = 127 Score = 65.9 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQSM 202 GG+MASEA+SLFRSFYEQGNPNAPKPHRPL + + Sbjct: 92 GGLMASEAISLFRSFYEQGNPNAPKPHRPLVQKKV 126 >XP_014493232.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X2 [Vigna radiata var. radiata] Length = 168 Score = 66.6 bits (161), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 135 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQT 168 >KYP57524.1 tRNA-specific adenosine deaminase 2 [Cajanus cajan] Length = 173 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 140 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQA 173 >XP_017406335.1 PREDICTED: tRNA-specific adenosine deaminase 2-like [Vigna angularis] XP_017406336.1 PREDICTED: tRNA-specific adenosine deaminase 2-like [Vigna angularis] Length = 182 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 149 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQT 182 >XP_014493231.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Vigna radiata var. radiata] Length = 182 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 149 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQT 182 >KHN17632.1 tRNA-specific adenosine deaminase 2 [Glycine soja] Length = 182 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 149 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQA 182 >XP_017409632.1 PREDICTED: tRNA-specific adenosine deaminase 2-like [Vigna angularis] KOM28958.1 hypothetical protein LR48_Vigan627s000700 [Vigna angularis] BAT76775.1 hypothetical protein VIGAN_01482800 [Vigna angularis var. angularis] Length = 183 Score = 66.6 bits (161), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMASEAV LFR+FYEQGNPNAPKPHRPLA Q+ Sbjct: 150 GGIMASEAVLLFRTFYEQGNPNAPKPHRPLARQT 183 >XP_008391198.1 PREDICTED: LOW QUALITY PROTEIN: tRNA-specific adenosine deaminase 2 [Malus domestica] Length = 175 Score = 65.9 bits (159), Expect = 3e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMA+EAVSLFRSFYEQGNPNAPKP RPLA Q+ Sbjct: 140 GGIMATEAVSLFRSFYEQGNPNAPKPQRPLAQQA 173 >XP_003624730.2 tRNA-specific adenosine deaminase [Medicago truncatula] ABN08468.1 CMP/dCMP deaminase, zinc-binding [Medicago truncatula] AES80948.2 tRNA-specific adenosine deaminase [Medicago truncatula] Length = 178 Score = 65.9 bits (159), Expect = 3e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GGIMA EAV L R+FYEQGNPNAPKPHRPLAHQ+ Sbjct: 143 GGIMAEEAVLLLRTFYEQGNPNAPKPHRPLAHQT 176 >XP_016680769.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Gossypium hirsutum] XP_016680770.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Gossypium hirsutum] XP_016680771.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Gossypium hirsutum] XP_016680772.1 PREDICTED: tRNA-specific adenosine deaminase 2-like isoform X1 [Gossypium hirsutum] Length = 183 Score = 65.9 bits (159), Expect = 4e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQSM 202 GG+MASEA+SLFRSFYEQGNPNAPKPHRPL + + Sbjct: 148 GGLMASEAISLFRSFYEQGNPNAPKPHRPLVQKKV 182 >XP_012460208.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Gossypium raimondii] XP_012460209.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Gossypium raimondii] XP_012460210.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Gossypium raimondii] XP_012460211.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Gossypium raimondii] KJB76956.1 hypothetical protein B456_012G114300 [Gossypium raimondii] KJB76957.1 hypothetical protein B456_012G114300 [Gossypium raimondii] KJB76958.1 hypothetical protein B456_012G114300 [Gossypium raimondii] KJB76960.1 hypothetical protein B456_012G114300 [Gossypium raimondii] Length = 183 Score = 65.9 bits (159), Expect = 4e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQSM 202 GG+MASEA+SLFRSFYEQGNPNAPKPHRPL + + Sbjct: 148 GGLMASEAISLFRSFYEQGNPNAPKPHRPLVQKKV 182 >XP_016574878.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Capsicum annuum] Length = 185 Score = 65.9 bits (159), Expect = 4e-11 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 306 GGIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQ 208 GGIMASEAVSL RSFYEQGNPNAPKPHRPL Q Sbjct: 152 GGIMASEAVSLLRSFYEQGNPNAPKPHRPLTQQ 184 >XP_018836613.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] XP_018836614.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] XP_018836615.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] XP_018836616.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] XP_018836617.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] XP_018836618.1 PREDICTED: tRNA-specific adenosine deaminase 2 [Juglans regia] Length = 191 Score = 65.9 bits (159), Expect = 4e-11 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 303 GIMASEAVSLFRSFYEQGNPNAPKPHRPLAHQS 205 GIMASEAVSL R+FYEQGNPNAPKPHRPL HQ+ Sbjct: 157 GIMASEAVSLLRTFYEQGNPNAPKPHRPLTHQA 189