BLASTX nr result
ID: Phellodendron21_contig00025926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025926 (463 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018271066.1 hypothetical protein RHOBADRAFT_53924 [Rhodotorul... 62 2e-08 XP_016271905.1 cAMP-dependent protein kinase regulatory subunit ... 62 3e-08 XP_012186355.1 hypothetical protein PHSY_000324 [Pseudozyma hube... 58 7e-07 CEQ39586.1 SPOSA6832_01119, partial [Sporidiobolus salmonicolor] 57 1e-06 XP_013245989.1 camp-binding domain-like protein [Tilletiaria ano... 57 1e-06 KNF06285.1 hypothetical protein PSTG_00791 [Puccinia striiformis... 55 6e-06 XP_016291925.1 hypothetical protein PSEUBRA_SCAF23g05171 [Kalman... 55 8e-06 >XP_018271066.1 hypothetical protein RHOBADRAFT_53924 [Rhodotorula graminis WP1] KPV75017.1 hypothetical protein RHOBADRAFT_53924 [Rhodotorula graminis WP1] Length = 596 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/46 (63%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQER--IRARAALTSSPT 332 L++LNR++LR+ PSDPLQFCA+WF Q+LEQER RA+A+ +SS T Sbjct: 11 LSDLNREVLRAQPSDPLQFCANWFAQRLEQERSATRAQASASSSTT 56 >XP_016271905.1 cAMP-dependent protein kinase regulatory subunit [Rhodotorula toruloides NP11] EMS20786.1 cAMP-dependent protein kinase regulatory subunit [Rhodotorula toruloides NP11] CDR40329.1 RHTO0S05e01640g1_1 [Rhodotorula toruloides] Length = 614 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAALT 344 L++LNR++LR+ PSDPLQFCA+WF +LEQERI ARA T Sbjct: 11 LSDLNREVLRAQPSDPLQFCANWFASRLEQERISARATGT 50 >XP_012186355.1 hypothetical protein PHSY_000324 [Pseudozyma hubeiensis SY62] GAC92768.1 hypothetical protein PHSY_000324 [Pseudozyma hubeiensis SY62] Length = 527 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAALTSSP 335 LN+LNRD+ R+ PSDPLQFCA+WF KLE++R RA L S+P Sbjct: 11 LNDLNRDVARARPSDPLQFCANWFNAKLEEQR---RAYLASTP 50 >CEQ39586.1 SPOSA6832_01119, partial [Sporidiobolus salmonicolor] Length = 638 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAALTS 341 L+ELNR++LR+ P+DPLQFCA+WF +LEQER R+ ++S Sbjct: 75 LSELNREVLRAQPTDPLQFCANWFASRLEQERNAFRSGVSS 115 >XP_013245989.1 camp-binding domain-like protein [Tilletiaria anomala UBC 951] KDN53150.1 camp-binding domain-like protein [Tilletiaria anomala UBC 951] Length = 580 Score = 57.0 bits (136), Expect = 1e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAA 350 LNELNR++LR+ P DPLQFCA+WF ++LE++R+ R+A Sbjct: 11 LNELNREVLRTRPIDPLQFCANWFNRRLEEQRVAHRSA 48 >KNF06285.1 hypothetical protein PSTG_00791 [Puccinia striiformis f. sp. tritici PST-78] Length = 700 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAALT 344 +NEL R+I+R++P+D LQFCASWF KLEQER + R L+ Sbjct: 12 INELEREIIRNTPADLLQFCASWFQNKLEQERTQIRTQLS 51 >XP_016291925.1 hypothetical protein PSEUBRA_SCAF23g05171 [Kalmanozyma brasiliensis GHG001] EST06936.1 hypothetical protein PSEUBRA_SCAF23g05171 [Kalmanozyma brasiliensis GHG001] Length = 504 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -1 Query: 463 LNELNRDILRSSPSDPLQFCASWFFQKLEQERIRARAALTSSP 335 LN+LNRD+ R+ P+DP+QFCA+WF KLE++R R +TS+P Sbjct: 11 LNDLNRDVARARPNDPVQFCANWFNAKLEEQR---RQHITSNP 50