BLASTX nr result
ID: Phellodendron21_contig00025761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00025761 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444949.1 hypothetical protein CICLE_v100190671mg, partial ... 93 9e-20 XP_006491189.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 1e-19 XP_002275491.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 9e-18 XP_007051704.2 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 EOX95861.1 Pentatricopeptide repeat superfamily protein, putativ... 86 3e-17 CDP08758.1 unnamed protein product [Coffea canephora] 83 3e-16 XP_009341118.2 PREDICTED: pentatricopeptide repeat-containing pr... 83 4e-16 XP_008356925.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 5e-16 XP_008232977.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 5e-16 AGZ20103.1 pentatricopeptide repeat-containing protein [Camellia... 81 1e-15 XP_008354009.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_008344990.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_007220199.1 hypothetical protein PRUPE_ppa003068mg [Prunus pe... 81 2e-15 ONI23253.1 hypothetical protein PRUPE_2G177500 [Prunus persica] 81 2e-15 EYU32173.1 hypothetical protein MIMGU_mgv1a002389mg [Erythranthe... 80 2e-15 XP_012843784.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-15 XP_015899583.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-15 XP_018841218.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 6e-15 XP_011092997.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 9e-15 KZV57660.1 pentatricopeptide repeat-containing protein mitochond... 79 9e-15 >XP_006444949.1 hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] ESR58189.1 hypothetical protein CICLE_v100190671mg, partial [Citrus clementina] Length = 450 Score = 92.8 bits (229), Expect = 9e-20 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AFKLMD+M EHAC+PDYI+MEILTEWLSE GQT+KLKKFVQGYA+SA PA Sbjct: 401 AFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA 450 >XP_006491189.1 PREDICTED: pentatricopeptide repeat-containing protein At5g28460 [Citrus sinensis] KDO86315.1 hypothetical protein CISIN_1g048807mg [Citrus sinensis] Length = 757 Score = 92.8 bits (229), Expect = 1e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AFKLMD+M EHAC+PDYI+MEILTEWLSE GQT+KLKKFVQGYA+SA PA Sbjct: 708 AFKLMDRMIEHACHPDYISMEILTEWLSEAGQTEKLKKFVQGYAVSAAPA 757 >XP_002275491.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] CBI40408.3 unnamed protein product, partial [Vitis vinifera] Length = 765 Score = 87.4 bits (215), Expect = 9e-18 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD+MTEHACNPDYITMEILTEWLS VG+T KLK FVQGY +SA A Sbjct: 716 AFELMDRMTEHACNPDYITMEILTEWLSAVGETAKLKSFVQGYEVSASAA 765 >XP_007051704.2 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Theobroma cacao] Length = 764 Score = 85.9 bits (211), Expect = 3e-17 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD M EHACNPDYITMEILTEWLS VG+++KLK FVQGY +S P A Sbjct: 715 AFRLMDSMVEHACNPDYITMEILTEWLSAVGESEKLKSFVQGYKVSTPAA 764 >EOX95861.1 Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 764 Score = 85.9 bits (211), Expect = 3e-17 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD M EHACNPDYITMEILTEWLS VG+++KLK FVQGY +S P A Sbjct: 715 AFRLMDSMVEHACNPDYITMEILTEWLSAVGESEKLKSFVQGYKVSTPAA 764 >CDP08758.1 unnamed protein product [Coffea canephora] Length = 777 Score = 83.2 bits (204), Expect = 3e-16 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISA 209 AFKLMD+MTE ACNPDY+TMEIL EWLS VGQT+KL++FVQGY +SA Sbjct: 728 AFKLMDEMTEKACNPDYVTMEILLEWLSAVGQTEKLRRFVQGYEVSA 774 >XP_009341118.2 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Pyrus x bretschneideri] Length = 775 Score = 82.8 bits (203), Expect = 4e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AFKLMD+M E ACNPDYITMEILTEWLS VG+T+KL++FVQGY ++A A Sbjct: 726 AFKLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAASTA 775 >XP_008356925.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AFKLMD+M E ACNPDYITMEILTEWLS VG+T+KL++FVQGY ++A A Sbjct: 725 AFKLMDQMIEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAASTA 774 >XP_008232977.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Prunus mume] Length = 776 Score = 82.4 bits (202), Expect = 5e-16 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+ MD+MTEHACNPDYITMEILTEWLS VG+ +KL++FVQGY ++A A Sbjct: 727 AFEFMDQMTEHACNPDYITMEILTEWLSTVGEMEKLRRFVQGYEVAASTA 776 >AGZ20103.1 pentatricopeptide repeat-containing protein [Camellia sinensis] Length = 771 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD+MTEHACNPDYITMEIL +WL VG+T+KL+ FVQGY +SA A Sbjct: 722 AFELMDQMTEHACNPDYITMEILIDWLPAVGETEKLRSFVQGYEVSASTA 771 >XP_008354009.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD+M E ACNPDYITMEILTEWLS VG+T+KL++FVQGY I+A A Sbjct: 725 AFQLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYDIAASTA 774 >XP_008344990.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Malus domestica] Length = 774 Score = 81.3 bits (199), Expect = 1e-15 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+LMD+M E ACNPDYITMEILTEWLS VG+T+KL++FVQGY I+A A Sbjct: 725 AFQLMDQMVEQACNPDYITMEILTEWLSAVGETEKLRRFVQGYDIAASTA 774 >XP_007220199.1 hypothetical protein PRUPE_ppa003068mg [Prunus persica] Length = 607 Score = 80.9 bits (198), Expect = 2e-15 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+ MD+M +HACNPDYITMEILTEWLS VG+T+KL++FVQGY ++A A Sbjct: 558 AFEFMDQMIKHACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAASTA 607 >ONI23253.1 hypothetical protein PRUPE_2G177500 [Prunus persica] Length = 774 Score = 80.9 bits (198), Expect = 2e-15 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF+ MD+M +HACNPDYITMEILTEWLS VG+T+KL++FVQGY ++A A Sbjct: 725 AFEFMDQMIKHACNPDYITMEILTEWLSAVGETEKLRRFVQGYEVAASTA 774 >EYU32173.1 hypothetical protein MIMGU_mgv1a002389mg [Erythranthe guttata] Length = 680 Score = 80.5 bits (197), Expect = 2e-15 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISA 209 A + MD+MTE ACNPDY+TMEILTEWLSEVG+ +KL+KFVQGY +SA Sbjct: 631 ALEFMDQMTEQACNPDYVTMEILTEWLSEVGEIEKLRKFVQGYQVSA 677 >XP_012843784.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Erythranthe guttata] Length = 747 Score = 80.5 bits (197), Expect = 3e-15 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISA 209 A + MD+MTE ACNPDY+TMEILTEWLSEVG+ +KL+KFVQGY +SA Sbjct: 698 ALEFMDQMTEQACNPDYVTMEILTEWLSEVGEIEKLRKFVQGYQVSA 744 >XP_015899583.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Ziziphus jujuba] Length = 765 Score = 80.5 bits (197), Expect = 3e-15 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AFK MD+M EHAC PDYITMEILTEWLS VG+T +LKKF +GY +SA A Sbjct: 716 AFKFMDQMVEHACGPDYITMEILTEWLSAVGETDRLKKFTKGYEVSAATA 765 >XP_018841218.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Juglans regia] Length = 766 Score = 79.3 bits (194), Expect = 6e-15 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISAPPA 200 AF LMD+M E ACNPDYITME+LTEWL VG+T KLKKFVQGY +S A Sbjct: 717 AFDLMDRMVEQACNPDYITMEVLTEWLPAVGETGKLKKFVQGYEVSVSTA 766 >XP_011092997.1 PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Sesamum indicum] Length = 742 Score = 79.0 bits (193), Expect = 9e-15 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -1 Query: 343 KLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAISA 209 + MD+MTE ACNPDY+TMEILTEWLS VG+T+KL+KFVQGY +SA Sbjct: 695 EFMDQMTEQACNPDYVTMEILTEWLSAVGETEKLRKFVQGYQVSA 739 >KZV57660.1 pentatricopeptide repeat-containing protein mitochondrial [Dorcoceras hygrometricum] Length = 750 Score = 79.0 bits (193), Expect = 9e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 349 AFKLMDKMTEHACNPDYITMEILTEWLSEVGQTKKLKKFVQGYAIS 212 A +LMD+MTEHAC PDYITMEILTEWLS VG+TKKL+ FV+GY +S Sbjct: 704 AIELMDQMTEHACKPDYITMEILTEWLSVVGETKKLQSFVRGYKVS 749